Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Name: Anti-Integrin alpha 5 Antibody [ARC0370]
Brand: Antibodies.com
SKU: A306223
Price: 470.0 USD
Availability: InStock

Enlarge Image

$470

Rabbit monoclonal [ARC0370] antibody to Integrin alpha 5 for WB, IHC, ICC/IF, IP and Flow Cytometry.

100% Guarantee

Price Match Guarantee

Delivery

Freight Charges

$40 to United States

Lead Time

5-8 Business Days

Contact Us

Telephone

+1 (314) 370-6046

orders@antibodies.com

Guarantees

100% Quality Guarantee

Price Match Guarantee

Specifications

Name

Anti-Integrin alpha 5 Antibody [ARC0370]

Description

Rabbit monoclonal [ARC0370] antibody to Integrin alpha 5.

Applications

WB, IHC, ICC/IF, IP, Flow Cytometry

Dilutions

WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200, IP: 1:500-1:1,000, Flow Cytometry: 1:50-1:200

Reactivity

Human, Mouse, Rat

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 950-1049 of human Integrin alpha 5 (ITGA5/CD49e) (P08648).

Sequence

HQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA

Host

Rabbit

Clonality

Monoclonal

Clone ID

ARC0370

Isotype

IgG

Conjugate

Unconjugated

Purification

Affinity purification.

Molecular Weight

17 kDa / 150 kDa

Product Form

Liquid

Formulation

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Storage

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Synonyms

CD49 antigen-like family member E, CD49e, Fibronectin receptor subunit alpha, Fibronectin receptor, alpha subunit, FNRA, Integrin alpha 5 (fibronectin receptor alpha), Integrin alpha-5, Integrin alpha-5 light chain, Integrin alpha-F, Integrin, alpha 5 (fibronectin receptor, alpha polypeptide), ITA5_HUMAN, Itga5, Very late activation protein 5, alpha subunit, VLA-5, VLA5, VLA5A

Isotype Controls

Suitable Secondaries

See all Anti-Rabbit IgG Secondaries →

Disclaimer

This product is for research use only. It is not intended for diagnostic or therapeutic use.

Scientific Validation Data (9)

Enlarge Image

Figure 1: Western Blot - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Western blot analysis of extracts of A-549 cells, using Anti-Integrin alpha 5 Antibody [ARC0370] (A306223) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 1s.

Enlarge Image

Figure 2: Western Blot - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Western blot analysis of extracts of various cell lines, using Anti-Integrin alpha 5 Antibody [ARC0370] (A306223) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 10s.

Enlarge Image

Figure 3: Western Blot - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Enlarge Image

Figure 4: Immunohistochemistry - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Immunohistochemistry analysis of paraffin-embedded human placenta using Anti-Integrin alpha 5 Antibody [ARC0370] (A306223) at a dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Enlarge Image

Figure 5: Immunofluorescence - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Immunofluorescence analysis of rat colon using Anti-Integrin alpha 5 Antibody [ARC0370] (A306223) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Enlarge Image

Figure 6: Western Blot - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Immunoprecipitation analysis of 300µg extracts of A549 cells using 3µg of Anti-Integrin alpha 5 Antibody [ARC0370] (A306223). This Western blot was performed on the immunoprecipitate using Anti-Integrin alpha 5 Antibody [ARC0370] (A306223) at a dilution of 1:1000.

Enlarge Image

Figure 7: Flow Cytometry - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Flow cytometry analysis of K562 cells, stained with Rabbit IgG isotype control (5 µg/ml, blue line) or Anti-Integrin alpha 5 Antibody [ARC0370] (A306223), (5 µg/ml green line), followed by Alexa Fluor 647 conjugated goat anti-rabbit polyclonal antibody (1:600 dilution) staining. Non-fluorescently stained K562 cells, used as blank control (red line).

Enlarge Image

Figure 8: Flow Cytometry - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Flow cytometry analysis of U-87MG cells, stained with Rabbit IgG isotype control (5 µg/ml, blue line) or Anti-Integrin alpha 5 Antibody [ARC0370] (A306223), (5 µg/ml green line), followed by Alexa Fluor 647 conjugated goat anti-rabbit polyclonal antibody (1:600 dilution) staining. Non-fluorescently stained U-87MG cells, used as blank control (red line).

Enlarge Image

Figure 9: Flow Cytometry - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Flow cytometry analysis of Daudi cells, stained with Rabbit IgG isotype control (5 µg/ml, blue line) or Anti-Integrin alpha 5 Antibody [ARC0370] (A306223), 5 µg/ml green line), followed by Alexa Fluor 647 conjugated goat anti-rabbit polyclonal antibody (1:600 dilution) staining. Non-fluorescently stained Daudi cells, used as blank control (red line).

Show more images

Publishing research using Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)? Please let us know so that we can list the citation on this page.