Anti-MUC1 Antibody (A89184)

Name: Anti-MUC1 Antibody
Brand: Antibodies.com
SKU: A89184
Price: 335.0 USD
Availability: InStock

Enlarge Image

$335

Rabbit polyclonal antibody to MUC1 for WB and IHC.

100% Guarantee

Price Match Guarantee

Delivery

Freight Charges

$40 to United States

Lead Time

5-8 Business Days

Contact Us

Telephone

+1 (314) 370-6046

orders@antibodies.com

Guarantees

100% Quality Guarantee

Price Match Guarantee

Specifications

Name

Anti-MUC1 Antibody

Description

Rabbit polyclonal antibody to MUC1.

Applications

WB, IHC

Dilutions

WB: 1:500-1:1,000, IHC: 1:50-1:200

Reactivity

Human, Mouse, Rat

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human MUC1 (P15941).

Sequence

EKNAVSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHDVTSAPDNKPAPGSTAPPAHGVTSAPDTRPAPGS

Host

Rabbit

Clonality

Polyclonal

Isotype

IgG

Conjugate

Unconjugated

Purification

Affinity purification.

Molecular Weight

23 - 30 kDa

Product Form

Liquid

Formulation

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Storage

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Synonyms

ADMCKD, ADMCKD1, Breast carcinoma associated antigen DF3, Breast carcinoma-associated antigen DF3, CA 15-3, CA15 3, CA15 3 antigen, CA15.3, Cancer antigen 15-3, Carcinoma associated mucin, Carcinoma-associated mucin, CD 227, CD227, DF3 antigen, EMA, Episialin, H23 antigen, H23AG, KL 6, KL-6, KL6, Krebs von den Lungen-6, MAM 6, MAM6, MCD, MCKD, MCKD1, Medullary cystic kidney disease 1 (autosomal dominant), Medullary cystic kidney disease, autosomal dominant, MUC 1, MUC-1, MUC-1/SEC, MUC-1/X, MUC1-alpha, MUC1-beta, MUC1-CT, MUC1-NT, MUC1/ZD, MUC1_HUMAN, Mucin 1, Mucin 1 transmembrane, Mucin 1, cell surface associated, Mucin-1 subunit beta, Peanut reactive urinary mucin, Peanut-reactive urinary mucin, PEM, PEMT, Polymorphic epithelial mucin, PUM, Tumor associated epithelial membrane antigen, Tumor associated epithelial mucin, Tumor associated mucin, Tumor-associated epithelial membrane antigen, Tumor-associated mucin

Isotype Controls

Suitable Secondaries

See all Anti-Rabbit IgG Secondaries →

Disclaimer

This product is for research use only. It is not intended for diagnostic or therapeutic use.

Scientific Validation Data (10)

Enlarge Image

Figure 1: Western Blot - Anti-MUC1 Antibody (A89184)

Western blot analysis of extracts of various cell lines, using Anti-MUC1 Antibody (A89184) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 60s.

Enlarge Image

Figure 2: Immunohistochemistry - Anti-MUC1 Antibody (A89184)

Immunohistochemistry analysis of paraffin-embedded rat lung using Anti-MUC1 Antibody (A89184) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 3: Immunohistochemistry - Anti-MUC1 Antibody (A89184)

Immunohistochemistry analysis of paraffin-embedded rat kidney using Anti-MUC1 Antibody (A89184) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 4: Immunohistochemistry - Anti-MUC1 Antibody (A89184)

Immunohistochemistry analysis of paraffin-embedded rat pancreas using Anti-MUC1 Antibody (A89184) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 5: Immunohistochemistry - Anti-MUC1 Antibody (A89184)

Immunohistochemistry analysis of paraffin-embedded human lung using Anti-MUC1 Antibody (A89184) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 6: Immunohistochemistry - Anti-MUC1 Antibody (A89184)

Immunohistochemistry analysis of paraffin-embedded human oophoroma using Anti-MUC1 Antibody (A89184) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 7: Immunohistochemistry - Anti-MUC1 Antibody (A89184)

Immunohistochemistry analysis of paraffin-embedded human placenta using Anti-MUC1 Antibody (A89184) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 8: Immunohistochemistry - Anti-MUC1 Antibody (A89184)

Immunohistochemistry analysis of paraffin-embedded human endometrium cancer using Anti-MUC1 Antibody (A89184) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 9: Immunohistochemistry - Anti-MUC1 Antibody (A89184)

Immunohistochemistry analysis of paraffin-embedded mouse lung using Anti-MUC1 Antibody (A89184) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Enlarge Image

Figure 10: Immunohistochemistry - Anti-MUC1 Antibody (A89184)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using Anti-MUC1 Antibody (A89184) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Show more images

Publishing research using Anti-MUC1 Antibody (A89184)? Please let us know so that we can list the citation on this page.