Anti-PRMT1 Antibody (A12991)

Anti-PRMT1 Antibody

Rabbit polyclonal antibody to PRMT1.

WB, IHC, ICC/IF

WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 270-371 of human PRMT1 (NP_001527.3).

PFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

ANM 1, ANM1, ANM1_HUMAN, HCP 1, HCP1, Heterogeneous nuclear ribonucleoprotein methyltransferase 1 like 2, Heterogeneous nuclear ribonucleoproteins methyltransferase like 2, Heterogeneous nuclear ribonucleoproteins methyltransferase like2, Histone-arginine N-methyltransferase PRMT1, HMT 2, HMT1 (hnRNP methyltransferase S. cerevisiae) like 2, HMT1 hnRNP methyltransferase, HMT1 hnRNP methyltransferase like 2, HMT1 hnRNP methyltransferase like 2 (S. cerevisiae), HMT2, HRMT1 L2, HRMT1L 2, HRMT1L2, Human mRNA for suppressor for yeast mutant, Human mRNA for suppressor for yeast mutant complete cds, Interferon receptor 1 bound protein 4, Interferon receptor 1 bound protein4, Interferon receptor 1-bound protein 4, Interferon receptor 1bound protein 4, IR1 B4, IR1B 4, IR1B4, Mrmt 1, Mrmt1, PRMT 1, Protein arginine methyltransferase 1, Protein arginine N methyltransferase 1, Protein arginine N methyltransferase1, Protein arginine N-methyltransferase 1, R1B4, S. cerevisiae like 2