Anti-RFTN2 Antibody (A92409)

Anti-RFTN2 Antibody

Rabbit polyclonal antibody to RFTN2.

WB: 1:500-1:2000

Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 412-501 of human RFTN2 (NP_653230.2).

KKASRHIKGEDKNKATSRSIGLDTTSSQPAESRHLPEECRLSPSRECWTKEGRLAQHNSFSGFSSSDNVLRELDDGQFDQEDGVTQVTCM

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

C2orf11, Raft-linking protein 2, Raftlin-2