Anti-SHC3 Antibody (A92362)

Anti-SHC3 Antibody

Rabbit polyclonal antibody to SHC3.

WB: 1:200-1:2000

Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 310-450 of human SHC3 (NP_058544.3).

QCPTKIPALHDRMQSLDEPWTEEEGDGSDHPYYNSIPSKMPPPGGFLDTRLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYSTPEGKLHVAPTGEAPTYVNTQQIPPQAWPAAVSSAESSPRKDL

Rabbit

Polyclonal

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

N-Shc, Neuronal Shc, NSHC, Protein Rai, SH2 domain protein C3, SHC-transforming protein 3, SHC-transforming protein C, SHCC, Src homology 2 domain-containing-transforming protein C3