Anti-SIRT3 Antibody [ARC51535] (A308370)

Anti-SIRT3 Antibody [ARC51535]

Rabbit monoclonal [ARC51535] antibody to SIRT3.

WB: 1:500-1:1,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 300-399 of human SIRT3 (NP_036371.1).

QRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK

Rabbit

Monoclonal

ARC51535

IgG

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

hSIRT 3, hSIRT3, Mitochondrial nicotinamide adenine dinucleotide dependent deacetylase, NAD dependent deacetylase sirtuin 3 mitochondrial, NAD-dependent protein deacetylase sirtuin-3, mitochondrial, Regulatory protein SIR2 homolog 3, Silent mating type information regulation 2 S.cerevisiae homolog 3, Sir 2 like 3, SIR 2 like protein 3, SIR 3, SIR2 L3, Sir2 like 3, SIR2 like protein 3, SIR2-like protein 3, SIR2L3, SIR3_HUMAN, SIRT 3, Sirtuin 3, Sirtuin silent mating type information regulation 2 homolog 3 (S. cerevisiae), Sirtuin type 3, Sirtuin3