+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
Antibodies.com LogoAntibodies.com Logo
Sign In / RegisterMy Account
0

Anti-c-Myc Antibody [ARC0412] (A307622)

Cut&Tag - Anti-c-Myc Antibody [ARC0412] (A307622) - Antibodies.com Western Blot - Anti-c-Myc Antibody [ARC0412] (A307622) - Antibodies.com Western Blot - Anti-c-Myc Antibody [ARC0412] (A307622) - Antibodies.com Western Blot - Anti-c-Myc Antibody [ARC0412] (A307622) - Antibodies.com Chromatin Immunoprecipitation - Anti-c-Myc Antibody [ARC0412] (A307622) - Antibodies.com
Knockout Validated
$470
Product Datasheet

Rabbit monoclonal [ARC0412] antibody to c-Myc for WB, IP and ChIP.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Freight Charges
$40 to United States
Lead Time
5-8 Business Days

Telephone
+1 (314) 370-6046
Mon - Fri, 8am - 4pm AST
Email
orders@antibodies.com

Name
Anti-c-Myc Antibody [ARC0412]
Description
Rabbit monoclonal [ARC0412] antibody to c-Myc.
Applications
WB, IP, ChIP
Dilutions
WB: 1:500-1:1,000, ChIP: 1:50-1:200, CUT&Tag: 16 cells/2µg
Reactivity
Human, Mouse
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human c-Myc (P01106).
Sequence
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLE
Host
Rabbit
Clonality
Monoclonal
Clone ID
ARC0412
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
50 - 60 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
AU016757, Avian myelocytomatosis viral oncogene homolog, bHLHe39, c Myc, Class E basic helix-loop-helix protein 39, MRTL, Myc, Myc Epitope Tag, Myc protein, Myc proto oncogene protein, Myc proto-oncogene protein, myc related translation/localization regulatory factor, myc-related translation/localization regulatory factor, Myc2, MYCC, MYC_HUMAN, Myelocytomatosis oncogene, Niard, Nird, oncogene c-Myc, Oncogene Myc, OTTHUMP00000158589, Proto-oncogene c-Myc, Protooncogene homologous to myelocytomatosis virus, RNCMYC, Transcription factor p64, Transcriptional regulator Myc-A, v myc avian myelocytomatosis viral oncogene homolog, v myc myelocytomatosis viral oncogene homolog, V-Myc avian myelocytomatosis viral oncogene homolog, v-myc myelocytomatosis viral oncogene homolog (avian)
Isotype Controls
Suitable Secondaries
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Cut&Tag - Anti-c-Myc Antibody [ARC0412] (A307622) - Antibodies.comEnlarge Image
Figure 1: Anti-c-Myc Antibody [ARC0412] (A307622)
CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina from 105 K562 cells with 2µg of Anti-c-Myc Antibody [ARC0412] (A307622), and Goat Anti-Rabbit IgG H&L Antibody. The CUT&Tag results indicate the enrichment pattern of c-Myc in representative gene loci (NPM1), as shown in figure.
Western Blot - Anti-c-Myc Antibody [ARC0412] (A307622) - Antibodies.comEnlarge Image
Figure 2: Western Blot - Anti-c-Myc Antibody [ARC0412] (A307622)
Western blot analysis of extracts of various cell lines, using Anti-c-Myc Antibody [ARC0412] (A307622) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 10s.
Western Blot - Anti-c-Myc Antibody [ARC0412] (A307622) - Antibodies.comEnlarge Image
Figure 3: Western Blot - Anti-c-Myc Antibody [ARC0412] (A307622)
Western blot analysis of extracts of Mouse ovary, using Anti-c-Myc Antibody [ARC0412] (A307622) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Enhanced Kit (RM00021). Exposure time: 3min.
Western Blot - Anti-c-Myc Antibody [ARC0412] (A307622) - Antibodies.comEnlarge Image
Figure 4: Western Blot - Anti-c-Myc Antibody [ARC0412] (A307622)
Western blot analysis of extracts from wild type (WT) and c-Myc knockout (KO) HCT116 cells, using Anti-c-Myc Antibody [ARC0412] (A307622) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 10s.
Publishing research using Anti-c-Myc Antibody [ARC0412] (A307622)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-c-Myc Antibody [ARC0412] (A307622)

Western Blot - Anti-c-Myc (phospho Thr58) Antibody (A12454) - Antibodies.com
(4)
A12454
Anti-c-Myc (phospho Thr58) Antibody
Rabbit polyclonal antibody to c-Myc (phospho Thr58) for WB and IHC.
Western Blot - Anti-c-Myc (phospho Ser62) Antibody (A12455) - Antibodies.com
(4)
A12455
Anti-c-Myc (phospho Ser62) Antibody
Rabbit polyclonal antibody to c-Myc (phospho Ser62) for WB and IHC.
Immunohistochemistry - Anti-c-Myc Antibody [9E10.3] (A249450) - Antibodies.com
(2)
A249451
Anti-c-Myc Antibody [9E10.3]
Mouse monoclonal [9E103] antibody to c-Myc for Flow Cytometry, IF and IHC-P.
SDS-PAGE - Anti-c-Myc Antibody [MYC699] (A249447) - Antibodies.com
A249448
Anti-c-Myc Antibody [MYC699]
Mouse monoclonal [MYC699] antibody to c-Myc for ELISA, Flow Cytometry and IF.
SDS-PAGE - Anti-c-Myc Antibody [MYC699] - BSA and Azide free (A252627) - Antibodies.com
A252628
Anti-c-Myc Antibody [MYC699] - BSA and Azide free
Mouse monoclonal [MYC699] antibody to c-Myc for ELISA, Flow Cytometry and IF.
Antibodies.com Image Placeholder - Discover more for less
A278887
Anti-c-Myc Antibody [9E10]
Mouse monoclonal [9E10] antibody to c-Myc for WB, IHC-P, IHC-Fr, ELISA and Flow Cytometry.
SDS-PAGE - Anti-c-Myc Antibody [MYC2895R] (A249457) - Antibodies.com
(2)
A249457
Anti-c-Myc Antibody [MYC2895R]
Recombinant rabbit monoclonal [MYC2895R] antibody to c-Myc for ELISA, Flow Cytometry and IF.
Immunohistochemistry - Anti-c-Myc Antibody [9E10.3] - BSA and Azide free (A252630) - Antibodies.com
(2)
A252631
Anti-c-Myc Antibody [9E10.3] - BSA and Azide free
Mouse monoclonal [9E103] antibody to c-Myc for Flow Cytometry, IF and IHC-P.
SDS-PAGE - Anti-c-Myc Antibody [MYC2895R] - BSA and Azide free (A252637) - Antibodies.com
(2)
A252637
Anti-c-Myc Antibody [MYC2895R] - BSA and Azide free
Recombinant rabbit monoclonal [MYC2895R] antibody to c-Myc for ELISA, Flow Cytometry and IF.
Immunohistochemistry - Anti-c-Myc Antibody [MYC909] (A249452) - Antibodies.com
A249453
Anti-c-Myc Antibody [MYC909]
Mouse monoclonal [MYC909] antibody to c-Myc for Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-c-Myc Antibody [MYC909] - BSA and Azide free (A252632) - Antibodies.com
A252633
Anti-c-Myc Antibody [MYC909] - BSA and Azide free
Mouse monoclonal [MYC909] antibody to c-Myc for Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-c-Myc Antibody [MYC275] - BSA and Azide free (A252628) - Antibodies.com
A252630
Anti-c-Myc Antibody [MYC275] - BSA and Azide free
Mouse monoclonal [MYC275] antibody to c-Myc for Flow Cytometry, IF and IHC-P.
Western Blot - Anti-c-Myc (phospho Thr58) Antibody (A12454) - Antibodies.com
(4)
A12454
Anti-c-Myc (phospho Thr58) Antibody
Rabbit polyclonal antibody to c-Myc (phospho Thr58) for WB and IHC.
Western Blot - Anti-c-Myc (phospho Ser62) Antibody (A12455) - Antibodies.com
(4)
A12455
Anti-c-Myc (phospho Ser62) Antibody
Rabbit polyclonal antibody to c-Myc (phospho Ser62) for WB and IHC.
Immunohistochemistry - Anti-c-Myc Antibody [9E10.3] (A249450) - Antibodies.com
(2)
A249451
Anti-c-Myc Antibody [9E10.3]
Mouse monoclonal [9E103] antibody to c-Myc for Flow Cytometry, IF and IHC-P.
SDS-PAGE - Anti-c-Myc Antibody [MYC699] (A249447) - Antibodies.com
A249448
Anti-c-Myc Antibody [MYC699]
Mouse monoclonal [MYC699] antibody to c-Myc for ELISA, Flow Cytometry and IF.
SDS-PAGE - Anti-c-Myc Antibody [MYC699] - BSA and Azide free (A252627) - Antibodies.com
A252628
Anti-c-Myc Antibody [MYC699] - BSA and Azide free
Mouse monoclonal [MYC699] antibody to c-Myc for ELISA, Flow Cytometry and IF.
Antibodies.com Image Placeholder - Discover more for less
A278887
Anti-c-Myc Antibody [9E10]
Mouse monoclonal [9E10] antibody to c-Myc for WB, IHC-P, IHC-Fr, ELISA and Flow Cytometry.
SDS-PAGE - Anti-c-Myc Antibody [MYC2895R] (A249457) - Antibodies.com
(2)
A249457
Anti-c-Myc Antibody [MYC2895R]
Recombinant rabbit monoclonal [MYC2895R] antibody to c-Myc for ELISA, Flow Cytometry and IF.
Immunohistochemistry - Anti-c-Myc Antibody [9E10.3] - BSA and Azide free (A252630) - Antibodies.com
(2)
A252631
Anti-c-Myc Antibody [9E10.3] - BSA and Azide free
Mouse monoclonal [9E103] antibody to c-Myc for Flow Cytometry, IF and IHC-P.
SDS-PAGE - Anti-c-Myc Antibody [MYC2895R] - BSA and Azide free (A252637) - Antibodies.com
(2)
A252637
Anti-c-Myc Antibody [MYC2895R] - BSA and Azide free
Recombinant rabbit monoclonal [MYC2895R] antibody to c-Myc for ELISA, Flow Cytometry and IF.
Immunohistochemistry - Anti-c-Myc Antibody [MYC909] (A249452) - Antibodies.com
A249453
Anti-c-Myc Antibody [MYC909]
Mouse monoclonal [MYC909] antibody to c-Myc for Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-c-Myc Antibody [MYC909] - BSA and Azide free (A252632) - Antibodies.com
A252633
Anti-c-Myc Antibody [MYC909] - BSA and Azide free
Mouse monoclonal [MYC909] antibody to c-Myc for Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-c-Myc Antibody [MYC275] - BSA and Azide free (A252628) - Antibodies.com
A252630
Anti-c-Myc Antibody [MYC275] - BSA and Azide free
Mouse monoclonal [MYC275] antibody to c-Myc for Flow Cytometry, IF and IHC-P.
See all Anti-c-Myc Antibodies
Main Menu Contact Us 0Checkout
Top