Anti-BRG1 Antibody [5B7] (A320277)

Anti-BRG1 Antibody [5B7]

Rat monoclonal [5B7] antibody to BRG1.

This antibody recognises special AT-rich sequence-binding protein 2, also known as transcription activator BRG1.SMARCA4 is a member of the SWI/SNF family of proteins. SWI/SNF proteins display ATPase and helicase activities and regulate gene transcription via chromatin remodelling. SMRCA4 is important for spermatogenesis and embryo development. SMARCA4 is also the most frequently mutated chromatin remodeling ATPase in cancer. Mutations in the SMARCA4 have been observed in many tumor subtypes including pancreatic cancers and some types of leukemia. Rat anti Human SMARCA4 antibody detects a band of 180 kDa.

IF, WB

IF: 2 µg/ml - 10 µg/ml, WB: 0.5 µg/ml - 2 µg/ml

Human, Mouse, Monkey

A recombinant protein corresponding to amino acids 213-295 of human SMARCA4.

MQQQMPTLPPPSVSATGPGPGPGPGPGPGPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAP

Rat

Monoclonal

5B7

IgG2a

1 mg/ml

Liquid

Supplied in Phosphate Buffered Saline with 0.035% Sodium Azide and 30% Glycerol.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Rat anti Human SMARCA4 antibody, clone 5B7 recognizes special AT-rich sequence-binding protein 2, also known as transcription activator BRG1.SMARCA4 is a member of the SWI/SNF family of proteins. SWI/SNF proteins display ATPase and helicase activities and regulate gene transcription via chromatin remodelling. SMRCA4 is important for spermatogenesis and embryo development (Kim et al. 2012) (Zhang et al. 2011). SMARCA4 is also the most frequently mutated chromatin remodeling ATPase in cancer. Mutations in the SMARCA4 have been observed in many tumor subtypes including pancreatic cancers and some types of leukemia (Jones et al. 2012) (Shain et al. 2012) (Hodges et al. 2018) (Romero et al. 2012).Rat anti Human SMARCA4 antibody detects a band of 180 kDa.

ATP-dependent helicase SMARCA4, BAF190A, BRG1-associated factor 190A, Mitotic growth and transcription activator, Protein brahma homolog 1, Protein BRG-1, SMARCA4, SNF2B, SNF2L4, Transcription activator BRG1