ISO 9001:2015 Certified
Live Customer Support
4.5/5 on Trustpilot
100% Quality Guarantee

Anti-TIM 3 Antibody [RMT3-23] (A281690)

Rat monoclonal [RMT3-23] antibody to TIM 3 for IHC-P, IF, Flow Cytometry and IHC-Fr.

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 5-7 business days.
Name
Anti-TIM 3 Antibody [RMT3-23]
Description
Rat monoclonal [RMT3-23] antibody to TIM 3.
Specificity
This antibody recognises mouse T-cell immunoglobulin mucin 3, a transmembrane glycoprotein and member of the immunoglobulin superfamily, preferentially expressed by differentiated CD4+ Th1 cells and CD8+ Tc1 (cytotoxic) cells, but not by CD4+ Th2 cells or CD8+ Tc2 cells.Tim-3 acts as a negative regulator of Th1-mediated inflammatory diseases including GVHD, type I diabetes, and EAE (experimental autoimmune encephamyelitis), promotes immunological tolerance, and is a receptor for galectin-9, shown to induce cell death of Th1 cells in vitro. Tim-3 is also involved in the regulation of macrophage activation, acts as a phagocytic receptor, and has been shown to recognize apoptotic cells via the IgV domain.Rat anti Mouse Tim-3 antibody, clone RMT3-23 significantly inhibits the efficient phagocytosis of apoptotic cells by peritoneal exudate Mac1+ cells.
Applications
IHC-P, IF, Flow Cytometry, IHC-Fr
Dilutions
Flow Cytometry: 1:25 - 1:200, Use 10µl of the suggested working dilution to label 106 cells in 100µl.
Reactivity
Mouse
Immunogen
Tim-3-Ig, consisting of amino acids 1-191 of mouse Tim-3, coupled with the Fc portion of mouse IgG2a.
Sequence
MFSGLTLNCVLLLLQLLLARSLENAYVFEVGKNAYLPCSYTLSTPGALVPMCWGKGFCPWSQCTNELLRTDERNVTYQKSSRYQLKGDLNKGDVSLIIKNVTLDDHGTYCCRIQFPGLMNDKKLELKLDIKAAKVTPAQTAHGDSTTASPRTLTTERNGSETQTLVTLHNNNGTKISTWADEIKDSGETIR
Host
Rat
Clonality
Monoclonal
Clone ID
RMT3-23
Isotype
IgG2a
Conjugate

Unconjugated

Purification
Protein G affinity chromatography of tissue culture supernatant.
Concentration
1 mg/ml
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline with 0.09% Sodium Azide.
Storage
Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.
General Notes
Rat anti Mouse Tim-3 antibody, clone RMT3-23 recognizes mouse T-cell immunoglobulin mucin 3, a transmembrane glycoprotein and member of the immunoglobulin superfamily, preferentially expressed by differentiated CD4+ Th1 cells and CD8+ Tc1 (cytotoxic) cells, but not by CD4+ Th2 cells or CD8+ Tc2 cells.Tim-3 acts as a negative regulator of Th1-mediated inflammatory diseases including GVHD, type I diabetes, and EAE (experimental autoimmune encephamyelitis), promotes immunological tolerance, and is a receptor for galectin-9, shown to induce cell death of Th1 cells in vitro. Tim-3 is also involved in the regulation of macrophage activation, acts as a phagocytic receptor, and has been shown to recognize apoptotic cells via the IgV domain.Rat anti Mouse Tim-3 antibody, clone RMT3-23 significantly inhibits the efficient phagocytosis of apoptotic cells by peritoneal exudate Mac1+ cells ( Nakayama et al. 2009).
Synonyms
CD366, HAVcr-2, HAVCR2, Hepatitis A virus cellular receptor 2, T-cell immunoglobulin and mucin domain-containing protein 3, T-cell immunoglobulin mucin receptor 3, T-cell membrane protein 3, TIM-3, TIM3, TIMD-3, TIMD3
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Publishing research using Anti-TIM 3 Antibody [RMT3-23] (A281690)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-TIM 3 Antibody [RMT3-23] (A281690)

Proteins predicted to interact with TIM 3

Predicted protein interactions based upon String database. Revelancy score correlates with probability of interaction.
99.9% Relevancy Score
99.8% Relevancy Score
99.5% Relevancy Score
99.1% Relevancy Score
98.8% Relevancy Score
97.2% Relevancy Score
97.1% Relevancy Score
94.1% Relevancy Score
93.5% Relevancy Score