ISO 9001:2015 Certified
Live Customer Support
4.5/5 on Trustpilot
100% Quality Guarantee

Anti-TLR4 Antibody (A283238)

Goat polyclonal antibody to TLR4 for WB and IHC-P.

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 5-7 business days.
Name
Anti-TLR4 Antibody
Description
Goat polyclonal antibody to TLR4.
Specificity
This antibody recognises the human Toll-like receptor 4, also known as CD284, hToll or TLR4. CD284 is an 839 amino acid ~96 kDa single pass type I transmembrane glycoprotein expressed by peripheral blood leucocytes, activated T cells, monocytes, macrophages, dendritic cells, granulocytes and endothelial cells. CD284 plays a primary role in the activation of innate immunity (UniProt: O00206).recognises an epitope within the N-terminal region of CD284, a highly conserved member of the toll-like receptor family which acts as a receptor for bacterial lipopolysaccharides (LPS) in co-operation with CD14 and MD2 (LY96), resulting in the activation of the MyD88-dependent and MyD88-independent (TRIF-dependent) signalling pathways and the production of inflammatory cytokines. LPS-activated CD284 can also induce dendritic cell maturation via TRIF-dependent signaling.Goat anti Human CD284 antibody is reported to be suitable for use in immunocytochemistry on acetone fixed cells.
Applications
WB, IHC-P
Dilutions
IHC-P 1: 1:100 - 1:300, WB: 1:500
Reactivity
Human, Mouse, Rat
Immunogen
Synthetic peptide sequence LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-terminus of human CD284.
Sequence
LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC
Host
Goat
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Concentration
1 mg/ml
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline with 0.1% BSA and 0.1% Sodium Azide.
Storage
Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.
General Notes
Goat anti Human CD284 antibody recognizes the human Toll-like receptor 4, also known as CD284, hToll or TLR4. CD284 is an 839 amino acid ~96 kDa single pass type I transmembrane glycoprotein expressed by peripheral blood leucocytes, activated T cells, monocytes, macrophages, dendritic cells, granulocytes and endothelial cells. CD284 plays a primary role in the activation of innate immunity (UniProt: O00206).Goat anti Human CD284 antibody recognizes an epitope within the N-terminal (NT) region of CD284, a highly conserved member of the toll-like receptor family which acts as a receptor for bacterial lipopolysaccharides (LPS) in co-operation with CD14 and MD2 (LY96), resulting in the activation of the MyD88-dependent and MyD88-independent (TRIF-dependent) signalling pathways and the production of inflammatory cytokines. LPS-activated CD284 can also induce dendritic cell maturation via TRIF-dependent signaling.Goat anti Human CD284 antibody is reported to be suitable for use in immunocytochemistry on acetone fixed cells.
Synonyms
CD284, hToll, Toll-like receptor 4
Isotype Controls
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Publishing research using Anti-TLR4 Antibody (A283238)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-TLR4 Antibody (A283238)

Proteins predicted to interact with TLR4

Predicted protein interactions based upon String database. Revelancy score correlates with probability of interaction.
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score
99.9% Relevancy Score