+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
Antibodies.com LogoAntibodies.com Logo
Sign In / RegisterMy Account
0

Anti-CD8 alpha Antibody (A89179)

Western Blot - Anti-CD8 alpha Antibody (A89179) - Antibodies.com Immunohistochemistry - Anti-CD8 alpha Antibody (A89179) - Antibodies.com Immunohistochemistry - Anti-CD8 alpha Antibody (A89179) - Antibodies.com
$335
Product Datasheet

Rabbit polyclonal antibody to CD8 alpha for WB and IHC.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Freight Charges
$40 to United States
Lead Time
5-8 Business Days

Telephone
+1 (314) 370-6046
Mon - Fri, 8am - 4pm AST
Email
orders@antibodies.com

Name
Anti-CD8 alpha Antibody
Description
Rabbit polyclonal antibody to CD8 alpha.
Applications
WB, IHC
Dilutions
WB: 1:100-1:500, IHC: 1:50-1:200
Reactivity
Human, Mouse
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 74-180 of human CD8A (NP_001759.3).
Sequence
SQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFA
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
26 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
alpha polypeptide (p32), CD8, CD8 antigen alpha polypeptide, CD8 antigen alpha polypeptide (p32), CD8a, CD8A antigen, CD8A molecule, CD8A_HUMAN, Leu2, Leu2 T lymphocyte antigen, Ly3, LYT3, MAL, OKT8 T cell antigen, OTTHUMP00000160760, OTTHUMP00000160764, OTTHUMP00000203528, OTTHUMP00000203721, p32, T cell antigen Leu2, T cell co receptor, T-cell surface glycoprotein CD8 alpha chain, T-lymphocyte differentiation antigen T8/Leu-2, T8 T cell antigen, T8/Leu-2 T-lymphocyte differentiation antigen
Isotype Controls
Suitable Secondaries
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Western Blot - Anti-CD8 alpha Antibody (A89179) - Antibodies.comEnlarge Image
Figure 1: Western Blot - Anti-CD8 alpha Antibody (A89179)
Western blot analysis of extracts of various cell lines, using Anti-CD8 alpha Antibody (A89179) at 1:500 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 180s.
Immunohistochemistry - Anti-CD8 alpha Antibody (A89179) - Antibodies.comEnlarge Image
Figure 2: Immunohistochemistry - Anti-CD8 alpha Antibody (A89179)
Immunohistochemistry analysis of paraffin-embedded human colon tissue using Anti-CD8 alpha Antibody (A89179) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-CD8 alpha Antibody (A89179) - Antibodies.comEnlarge Image
Figure 3: Immunohistochemistry - Anti-CD8 alpha Antibody (A89179)
Immunohistochemistry analysis of paraffin-embedded human tonsil using Anti-CD8 alpha Antibody (A89179) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Publishing research using Anti-CD8 alpha Antibody (A89179)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-CD8 alpha Antibody (A89179)

Antibodies.com Image Placeholder - Discover more for less
A86749
12 Citations
Anti-CD8 alpha Antibody [53-6.7]
Rat monoclonal [53-67] antibody to CD8 alpha for Flow Cytometry, IP, IHC-P, IHC-Fr and ICC.
Antibodies.com Image Placeholder - Discover more for less
A86620
10 Citations
Anti-CD8 alpha Antibody [OX-8]
Mouse monoclonal [OX-8] antibody to CD8 alpha for Flow Cytometry, IP, WB, IHC-P and IHC-Fr.
Western Blot - Anti-CD8 alpha Antibody [ARC0329] (A306457) - Antibodies.com
(7)
A306457
Anti-CD8 alpha Antibody [ARC0329]
Rabbit monoclonal [ARC0329] antibody to CD8 alpha for WB, IHC and Flow Cytometry.
Antibodies.com Image Placeholder - Discover more for less
A86753
3 Citations
Anti-CD8 alpha Antibody [53-6.7] - Low endotoxin, Azide free
Rat monoclonal [53-67] antibody to CD8 alpha for Flow Cytometry, IP, IHC-P, IHC-Fr, ICC and Functional Studies.
Antibodies.com Image Placeholder - Discover more for less
A281502
Anti-CD8 alpha Antibody [OX-8]
Mouse monoclonal [OX-8] antibody to CD8 alpha for WB, IHC-P, IP, Flow Cytometry, IHC-Fr and IF.
Antibodies.com Image Placeholder - Discover more for less
A281501
Anti-CD8 alpha Antibody [OX-8] - BSA and Azide free
Mouse monoclonal [OX-8] antibody to CD8 alpha for IHC-Fr, IHC-P, WB, Flow Cytometry, IP and Functional Assays.
Antibodies.com Image Placeholder - Discover more for less
A285843
Anti-CD8 alpha Antibody [OX-8] - Low endotoxin, Azide free
Mouse monoclonal [OX-8] antibody to CD8 alpha for WB, IHC-P, Functional Studies, Flow Cytometry, IP and IHC-Fr.
Western Blot - Anti-CD8-alpha Antibody (R12-2084) - Antibodies.com
A99745
Anti-CD8-alpha Antibody
Rabbit polyclonal antibody to CD8-alpha for WB and ELISA.
Antibodies.com Image Placeholder - Discover more for less
A282104
Anti-CD8 alpha Antibody [YTS105.18]
Rat monoclonal [YTS10518] antibody to CD8 alpha for Flow Cytometry, IHC-Fr and IF.
Antibodies.com Image Placeholder - Discover more for less
A279986
Anti-CD8 alpha Antibody [CA9.JD3]
Mouse monoclonal [CA9JD3] antibody to CD8 alpha for IHC-Fr, IP and Flow Cytometry.
Antibodies.com Image Placeholder - Discover more for less
A280269
Anti-CD8 alpha Antibody [Du CD8-1]
Mouse monoclonal [Du CD8-1] antibody to CD8 alpha for IHC-P, Flow Cytometry and IP.
Antibodies.com Image Placeholder - Discover more for less
A280830
Anti-CD8 alpha Antibody [KT15]
Rat monoclonal [KT15] antibody to CD8 alpha for Flow Cytometry, IHC-Fr and IF.
Antibodies.com Image Placeholder - Discover more for less
A86749
12 Citations
Anti-CD8 alpha Antibody [53-6.7]
Rat monoclonal [53-67] antibody to CD8 alpha for Flow Cytometry, IP, IHC-P, IHC-Fr and ICC.
Antibodies.com Image Placeholder - Discover more for less
A86620
10 Citations
Anti-CD8 alpha Antibody [OX-8]
Mouse monoclonal [OX-8] antibody to CD8 alpha for Flow Cytometry, IP, WB, IHC-P and IHC-Fr.
Western Blot - Anti-CD8 alpha Antibody [ARC0329] (A306457) - Antibodies.com
(7)
A306457
Anti-CD8 alpha Antibody [ARC0329]
Rabbit monoclonal [ARC0329] antibody to CD8 alpha for WB, IHC and Flow Cytometry.
Antibodies.com Image Placeholder - Discover more for less
A86753
3 Citations
Anti-CD8 alpha Antibody [53-6.7] - Low endotoxin, Azide free
Rat monoclonal [53-67] antibody to CD8 alpha for Flow Cytometry, IP, IHC-P, IHC-Fr, ICC and Functional Studies.
Antibodies.com Image Placeholder - Discover more for less
A281502
Anti-CD8 alpha Antibody [OX-8]
Mouse monoclonal [OX-8] antibody to CD8 alpha for WB, IHC-P, IP, Flow Cytometry, IHC-Fr and IF.
Antibodies.com Image Placeholder - Discover more for less
A281501
Anti-CD8 alpha Antibody [OX-8] - BSA and Azide free
Mouse monoclonal [OX-8] antibody to CD8 alpha for IHC-Fr, IHC-P, WB, Flow Cytometry, IP and Functional Assays.
Antibodies.com Image Placeholder - Discover more for less
A285843
Anti-CD8 alpha Antibody [OX-8] - Low endotoxin, Azide free
Mouse monoclonal [OX-8] antibody to CD8 alpha for WB, IHC-P, Functional Studies, Flow Cytometry, IP and IHC-Fr.
Western Blot - Anti-CD8-alpha Antibody (R12-2084) - Antibodies.com
A99745
Anti-CD8-alpha Antibody
Rabbit polyclonal antibody to CD8-alpha for WB and ELISA.
Antibodies.com Image Placeholder - Discover more for less
A282104
Anti-CD8 alpha Antibody [YTS105.18]
Rat monoclonal [YTS10518] antibody to CD8 alpha for Flow Cytometry, IHC-Fr and IF.
Antibodies.com Image Placeholder - Discover more for less
A279986
Anti-CD8 alpha Antibody [CA9.JD3]
Mouse monoclonal [CA9JD3] antibody to CD8 alpha for IHC-Fr, IP and Flow Cytometry.
Antibodies.com Image Placeholder - Discover more for less
A280269
Anti-CD8 alpha Antibody [Du CD8-1]
Mouse monoclonal [Du CD8-1] antibody to CD8 alpha for IHC-P, Flow Cytometry and IP.
Antibodies.com Image Placeholder - Discover more for less
A280830
Anti-CD8 alpha Antibody [KT15]
Rat monoclonal [KT15] antibody to CD8 alpha for Flow Cytometry, IHC-Fr and IF.
See all Anti-CD8 alpha Antibodies
Main Menu Contact Us 0Checkout
Top