+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
Antibodies.com LogoAntibodies.com Logo
Sign In / RegisterMy Account
0

Anti-CD8 alpha Antibody [ARC0329] (A306457)

Western Blot - Anti-CD8 alpha Antibody [ARC0329] (A306457) - Antibodies.com Immunohistochemistry - Anti-CD8 alpha Antibody [ARC0329] (A306457) - Antibodies.com Immunohistochemistry - Anti-CD8 alpha Antibody [ARC0329] (A306457) - Antibodies.com Immunohistochemistry - Anti-CD8 alpha Antibody [ARC0329] (A306457) - Antibodies.com Flow Cytometry - Anti-CD8 alpha Antibody [ARC0329] (A306457) - Antibodies.com Flow Cytometry - Anti-CD8 alpha Antibody [ARC0329] (A306457) - Antibodies.com Flow Cytometry - Anti-CD8 alpha Antibody [ARC0329] (A306457) - Antibodies.com
$470
Product Datasheet

Rabbit monoclonal [ARC0329] antibody to CD8 alpha for WB, IHC and Flow Cytometry.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Freight Charges
$40 to United States
Lead Time
5-8 Business Days

Telephone
+1 (314) 370-6046
Mon - Fri, 8am - 4pm AST
Email
orders@antibodies.com

Name
Anti-CD8 alpha Antibody [ARC0329]
Description
Rabbit monoclonal [ARC0329] antibody to CD8 alpha.
Applications
WB, IHC, Flow Cytometry
Dilutions
WB: 1:500-1:2,000, IHC: 1:50-1:200, Flow Cytometry: 1:50-1:200
Reactivity
Human
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 136-235 of human CD8A (P01732).
Sequence
KPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
Host
Rabbit
Clonality
Monoclonal
Clone ID
ARC0329
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
35 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
alpha polypeptide (p32), CD8, CD8 antigen alpha polypeptide, CD8 antigen alpha polypeptide (p32), CD8a, CD8A antigen, CD8A molecule, CD8A_HUMAN, Leu2, Leu2 T lymphocyte antigen, Ly3, LYT3, MAL, OKT8 T cell antigen, OTTHUMP00000160760, OTTHUMP00000160764, OTTHUMP00000203528, OTTHUMP00000203721, p32, T cell antigen Leu2, T cell co receptor, T-cell surface glycoprotein CD8 alpha chain, T-lymphocyte differentiation antigen T8/Leu-2, T8 T cell antigen, T8/Leu-2 T-lymphocyte differentiation antigen
Isotype Controls
Suitable Secondaries
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Western Blot - Anti-CD8 alpha Antibody [ARC0329] (A306457) - Antibodies.comEnlarge Image
Figure 1: Western Blot - Anti-CD8 alpha Antibody [ARC0329] (A306457)
Western blot analysis of extracts of various cell lines, using Anti-CD8 alpha Antibody [ARC0329] (A306457) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 3min.
Immunohistochemistry - Anti-CD8 alpha Antibody [ARC0329] (A306457) - Antibodies.comEnlarge Image
Figure 2: Immunohistochemistry - Anti-CD8 alpha Antibody [ARC0329] (A306457)
Immunohistochemistry analysis of paraffin-embedded human intestinal T-cell lymphoma using Anti-CD8 alpha Antibody [ARC0329] (A306457) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-CD8 alpha Antibody [ARC0329] (A306457) - Antibodies.comEnlarge Image
Figure 3: Immunohistochemistry - Anti-CD8 alpha Antibody [ARC0329] (A306457)
Immunohistochemistry analysis of paraffin-embedded human T-cell malignant lymphoma using Anti-CD8 alpha Antibody [ARC0329] (A306457) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-CD8 alpha Antibody [ARC0329] (A306457) - Antibodies.comEnlarge Image
Figure 4: Immunohistochemistry - Anti-CD8 alpha Antibody [ARC0329] (A306457)
Immunohistochemistry analysis of paraffin-embedded human tonsil using Anti-CD8 alpha Antibody [ARC0329] (A306457) at a dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Publishing research using Anti-CD8 alpha Antibody [ARC0329] (A306457)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-CD8 alpha Antibody [ARC0329] (A306457)

Antibodies.com Image Placeholder - Discover more for less
A86749
12 Citations
Anti-CD8 alpha Antibody [53-6.7]
Rat monoclonal [53-67] antibody to CD8 alpha for Flow Cytometry, IP, IHC-P, IHC-Fr and ICC.
Antibodies.com Image Placeholder - Discover more for less
A86620
10 Citations
Anti-CD8 alpha Antibody [OX-8]
Mouse monoclonal [OX-8] antibody to CD8 alpha for Flow Cytometry, IP, WB, IHC-P and IHC-Fr.
Antibodies.com Image Placeholder - Discover more for less
A86753
3 Citations
Anti-CD8 alpha Antibody [53-6.7] - Low endotoxin, Azide free
Rat monoclonal [53-67] antibody to CD8 alpha for Flow Cytometry, IP, IHC-P, IHC-Fr, ICC and Functional Studies.
Western Blot - Anti-CD8 alpha Antibody (A89179) - Antibodies.com
(3)
A89179
Anti-CD8 alpha Antibody
Rabbit polyclonal antibody to CD8 alpha for WB and IHC.
Antibodies.com Image Placeholder - Discover more for less
A281502
Anti-CD8 alpha Antibody [OX-8]
Mouse monoclonal [OX-8] antibody to CD8 alpha for WB, IHC-P, IP, Flow Cytometry, IHC-Fr and IF.
Antibodies.com Image Placeholder - Discover more for less
A281501
Anti-CD8 alpha Antibody [OX-8] - BSA and Azide free
Mouse monoclonal [OX-8] antibody to CD8 alpha for IHC-Fr, IHC-P, WB, Flow Cytometry, IP and Functional Assays.
Antibodies.com Image Placeholder - Discover more for less
A285843
Anti-CD8 alpha Antibody [OX-8] - Low endotoxin, Azide free
Mouse monoclonal [OX-8] antibody to CD8 alpha for WB, IHC-P, Functional Studies, Flow Cytometry, IP and IHC-Fr.
Western Blot - Anti-CD8-alpha Antibody (R12-2084) - Antibodies.com
A99745
Anti-CD8-alpha Antibody
Rabbit polyclonal antibody to CD8-alpha for WB and ELISA.
Antibodies.com Image Placeholder - Discover more for less
A282104
Anti-CD8 alpha Antibody [YTS105.18]
Rat monoclonal [YTS10518] antibody to CD8 alpha for Flow Cytometry, IHC-Fr and IF.
Antibodies.com Image Placeholder - Discover more for less
A279986
Anti-CD8 alpha Antibody [CA9.JD3]
Mouse monoclonal [CA9JD3] antibody to CD8 alpha for IHC-Fr, IP and Flow Cytometry.
Antibodies.com Image Placeholder - Discover more for less
A280269
Anti-CD8 alpha Antibody [Du CD8-1]
Mouse monoclonal [Du CD8-1] antibody to CD8 alpha for IHC-P, Flow Cytometry and IP.
Antibodies.com Image Placeholder - Discover more for less
A280830
Anti-CD8 alpha Antibody [KT15]
Rat monoclonal [KT15] antibody to CD8 alpha for Flow Cytometry, IHC-Fr and IF.
Antibodies.com Image Placeholder - Discover more for less
A86749
12 Citations
Anti-CD8 alpha Antibody [53-6.7]
Rat monoclonal [53-67] antibody to CD8 alpha for Flow Cytometry, IP, IHC-P, IHC-Fr and ICC.
Antibodies.com Image Placeholder - Discover more for less
A86620
10 Citations
Anti-CD8 alpha Antibody [OX-8]
Mouse monoclonal [OX-8] antibody to CD8 alpha for Flow Cytometry, IP, WB, IHC-P and IHC-Fr.
Antibodies.com Image Placeholder - Discover more for less
A86753
3 Citations
Anti-CD8 alpha Antibody [53-6.7] - Low endotoxin, Azide free
Rat monoclonal [53-67] antibody to CD8 alpha for Flow Cytometry, IP, IHC-P, IHC-Fr, ICC and Functional Studies.
Western Blot - Anti-CD8 alpha Antibody (A89179) - Antibodies.com
(3)
A89179
Anti-CD8 alpha Antibody
Rabbit polyclonal antibody to CD8 alpha for WB and IHC.
Antibodies.com Image Placeholder - Discover more for less
A281502
Anti-CD8 alpha Antibody [OX-8]
Mouse monoclonal [OX-8] antibody to CD8 alpha for WB, IHC-P, IP, Flow Cytometry, IHC-Fr and IF.
Antibodies.com Image Placeholder - Discover more for less
A281501
Anti-CD8 alpha Antibody [OX-8] - BSA and Azide free
Mouse monoclonal [OX-8] antibody to CD8 alpha for IHC-Fr, IHC-P, WB, Flow Cytometry, IP and Functional Assays.
Antibodies.com Image Placeholder - Discover more for less
A285843
Anti-CD8 alpha Antibody [OX-8] - Low endotoxin, Azide free
Mouse monoclonal [OX-8] antibody to CD8 alpha for WB, IHC-P, Functional Studies, Flow Cytometry, IP and IHC-Fr.
Western Blot - Anti-CD8-alpha Antibody (R12-2084) - Antibodies.com
A99745
Anti-CD8-alpha Antibody
Rabbit polyclonal antibody to CD8-alpha for WB and ELISA.
Antibodies.com Image Placeholder - Discover more for less
A282104
Anti-CD8 alpha Antibody [YTS105.18]
Rat monoclonal [YTS10518] antibody to CD8 alpha for Flow Cytometry, IHC-Fr and IF.
Antibodies.com Image Placeholder - Discover more for less
A279986
Anti-CD8 alpha Antibody [CA9.JD3]
Mouse monoclonal [CA9JD3] antibody to CD8 alpha for IHC-Fr, IP and Flow Cytometry.
Antibodies.com Image Placeholder - Discover more for less
A280269
Anti-CD8 alpha Antibody [Du CD8-1]
Mouse monoclonal [Du CD8-1] antibody to CD8 alpha for IHC-P, Flow Cytometry and IP.
Antibodies.com Image Placeholder - Discover more for less
A280830
Anti-CD8 alpha Antibody [KT15]
Rat monoclonal [KT15] antibody to CD8 alpha for Flow Cytometry, IHC-Fr and IF.
See all Anti-CD8 alpha Antibodies
Main Menu Contact Us 0Checkout
Top