Anti-EpCAM Antibody (A13353)

Anti-EpCAM Antibody

Rabbit polyclonal antibody to EpCAM.

WB, ICC/IF

WB: 1:500-1:1,000, ICC/IF: 1:50-1:200

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 24-265 of human EpCAM (NP_002345.2).

QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

35 - 45 kDa

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

17 1A, 323/A3, Adenocarcinoma associated antigen, Adenocarcinoma-associated antigen, Antigen identified by monoclonal, AUA1, CD326, CD326 antigen, Cell surface glycoprotein Trop 1, Cell surface glycoprotein Trop 2, Cell surface glycoprotein Trop-1, CO 17A, CO17 1A, CO17A, DIAR5, EGP, EGP 2, EGP2, EGP314, EGP40, Ep CAM, Ep-CAM, EpCAM1, EPCAM_HUMAN, Epithelial cell adhesion molecule, Epithelial Cell Adhesion Molecule Intracellular Domain (EpCAM-ICD), Epithelial cell surface antigen, Epithelial cellular adhesion molecule, Epithelial glycoprotein, Epithelial glycoprotein 1, Epithelial glycoprotein 314, ESA, GA733 1, GA733 2, GA733-2, gastrointestinal tumor-associated antigen 2, 35-KD glycoprotein, gp4, hEGP 2, hEGP314, HNPCC8, Human epithelial glycoprotein 2, KS 1/4 antigen, KS1/4, KSA, Ly74, Lymphocyte antigen 74, M1S 1, M1S2, M4S1, Major gastrointestinal tumor associated protein GA733 2, Major gastrointestinal tumor-associated protein GA733-2, mEGP314, Membrane component chromosome 4 surface marker (35kD glycoprotein), Membrane component, chromosome 4, surface marker, Membrane component, chromosome 4, surface marker 1, MIC18, MK 1, Protein 289A, TACD1, TACSTD1, TROP1, Tumor associated calcium signal transducer 1, Tumor associated calcium signal transducer 2 precursor, Tumor-associated calcium signal transducer 1