Anti-IL-6 Antibody (A81167)

Anti-IL-6 Antibody

Rabbit polyclonal antibody to IL-6.

WB: 1:500-1:2,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 30-212 of human IL6 (NP_000591.1).

VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Rabbit

Polyclonal

IgG

Unconjugated

23 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

B cell differentiation factor , B cell stimulatory factor 2, B-cell stimulatory factor 2, BSF 2, BSF-2, BSF2, CDF, CTL differentiation factor, Cytotoxic T cell differentiation factor , Hepatocyte stimulating fact, Hepatocyte stimulating factor, Hepatocyte stimulatory factor, HGF, HPGF, HSF , Hybridoma growth factor, Hybridoma growth factor Interferon beta-2, Hybridoma plasmacytoma growth factor , IFN-beta-2, IFNB2 , IL 6, IL6, IL6 protein , IL6_HUMAN, Interferon beta 2, Interferon beta-2, Interleukin 6, Interleukin 6 (interferon beta 2) , Interleukin BSF 2, Interleukin BSF2, Interleukin-6, Interleukin6