Anti-MCAM Antibody (A13774)

Anti-MCAM Antibody

Rabbit polyclonal antibody to MCAM.

WB: 1:1000-1:2000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 447-646 of human MCAM (NP_006491.2).

VLNLSCEASGHPRPTISWNVNGTASEQDQDPQRVLSTLNVLVTPELLETGVECTASNDLGKNTSILFLELVNLTTLTPDSNTTTGLSTSTASPHTRANSTSTERKLPEPESRGVVIVAVIVCILVLAVLGAVLYFLYKKGKLPCRRSGKQEITLPPSRKSELVVEVKSDKLPEEMGLLQGSSGDKRAPGDQGEKYIDLRH

Rabbit

Polyclonal

IgG

Unconjugated

120kDa

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

A32 antigen, CD 146, CD146, CD146 antigen, Cell surface glycoprotein MUC18, Cell surface glycoprotein P1H12, Gicerin, Melanoma adhesion molecule, Melanoma associated antigen A32, Melanoma associated antigen MUC18, Melanoma associated glycoprotein MUC18, Melanoma cell adhesion molecule, Melanoma-associated antigen A32, Melanoma-associated antigen MUC18, MelCAM, MUC 18, MUC18, MUC18_HUMAN, S endo 1, S endo 1 endothelial associated antigen, S-endo 1 endothelial-associated antigen