Anti-ABCA1 Antikörper (A12095)

Anti-ABCA1 Antibody

Rabbit polyclonal antibody to ABCA1.

ICC/IF

ICC/IF: 1:50-1:200

Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 70-300 of human ABCA1 (NP_005493.2).

VQGIICNANNPCFRYPTPGEAPGVVGNFNKSIVARLFSDARRLLLYSQKDTSMKDMRKVLRTLQQIKKSSSNLKLQDFLVDNETFSGFLYHNLSLPKSTVDKMLRADVILHKVFLQGYQLHLTSLCNGSKSEEMIQLGDQEVSELCGLPREKLAAAERVLRSNMDILKPILRTLNSTSPFPSKELAEATKTLLHSLGTLAQELFSMRSWSDMRQEVMFLTNVNSSSSSTQI

Rabbit

Polyclonal

IgG

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

ABC 1, ABC Transporter 1, ABC-1, ABC1, ABCA 1, ABCA1_HUMAN, ATP binding Cassette 1, ATP binding cassette sub family A ABC1 member 1, ATP binding cassette sub family A member 1, ATP binding Cassette Transporter 1, ATP-binding cassette 1, ATP-binding cassette sub-family A member 1, ATP-binding cassette transporter 1, CERP, Cholesterol efflux regulatory protein, FLJ14958, HDLDT1, Membrane bound, MGC164864, MGC165011, TD, TGD