Kontakt
+1 (314) 370-6046 oderKontakt
Visit our English Website
Antibodies.com LogoAntibodies.com Logo
Einloggen / AnmeldenMein Konto
0

Anti-alpha smooth muscle Actin Antikörper (A89813)

Western Blot - Anti-alpha smooth muscle Actin Antibody (A89813) - Antibodies.com Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813) - Antibodies.com Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813) - Antibodies.com Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813) - Antibodies.com Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813) - Antibodies.com Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813) - Antibodies.com Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813) - Antibodies.com +4
$335
Product Datasheet

Polyklonal Kaninchen Antikörper gegen alpha smooth muscle Actin für WB, IHC und ICC/IF.

100% Qualitätsgarantie
Preis-Match-Garantie

Versandkosten
$40
Vorlaufzeit
Lieferung in 5-8 Werktagen

Telefon
+1 (314) 370-6046
Mo bis Frei, 8am - 4pm AST
Email
orders@antibodies.com

Empfohlene Produkte für Anti-alpha smooth muscle Actin Antikörper

Western Blot - Anti-alpha smooth muscle Actin Antibody (A82445)
(7)
A82445
1 Produktreferenz
Anti-alpha smooth muscle Actin Antikörper
Polyklonal Ziege Antikörper gegen alpha smooth muscle Actin für ELISA und WB.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody - Antibodies.com (A8234)
A8234
Anti-alpha Smooth Muscle Actin Antikörper [M16-L]
Monoklonal [M16-L] Kaninchen Antikörper gegen alpha Smooth Muscle Actin für IHC-P und IHC-Fr.
Western Blot - Anti-alpha smooth muscle Actin Antibody (A82445)
(7)
A82445
1 Produktreferenz
Anti-alpha smooth muscle Actin Antikörper
Polyklonal Ziege Antikörper gegen alpha smooth muscle Actin für ELISA und WB.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody - Antibodies.com (A8234)
A8234
Anti-alpha Smooth Muscle Actin Antikörper [M16-L]
Monoklonal [M16-L] Kaninchen Antikörper gegen alpha Smooth Muscle Actin für IHC-P und IHC-Fr.
Produktname
Anti-alpha smooth muscle Actin Antibody
Beschreibung
Rabbit polyclonal antibody to alpha smooth muscle Actin.
Anwendungen
WB, IHC, ICC/IF
Verdünnungen
WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200
Reaktivität
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-124 of human a-Smooth Muscle Actin (ACTA2) (NP_001135417.1).
Sequenz
MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQI
Wirt
Rabbit
Klonalität
Polyclonal
Isotyp
IgG
Konjugat

Unconjugated

Reinigung
Affinity purification.
Molekulargewicht
42 kDa
Produktform
Liquid
Formulierung
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Lagerung
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyme
a actin, AAT6, ACTA2, ACTA_HUMAN, Actin alpha 2 smooth muscle aorta, Actin aortic smooth muscle, Actin, aortic smooth muscle, ACTSA, ACTVS, Alpha 2 actin, Alpha actin 2, Alpha cardiac actin, alpha sma, Alpha-actin-2, Cell growth inhibiting gene 46 protein, Cell growth-inhibiting gene 46 protein, GIG46, Growth inhibiting gene 46, MYMY5
Isotyp-Kontrollantikörper
Kompatible Sekundärantikörper
Haftungsausschluss
Dieses Produkt ist nur für Forschungszwecke bestimmt. Es ist nicht für diagnostische oder therapeutische Zwecke bestimmt.
Western Blot - Anti-alpha smooth muscle Actin Antibody (A89813) - Antibodies.comBild Vergrößern
Figure 1: Western Blot - Anti-alpha smooth muscle Actin Antibody (A89813)
Western blot analysis of Mouse heart, using Anti-alpha smooth muscle Actin Antibody (A89813) at 1:800 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813) - Antibodies.comBild Vergrößern
Figure 2: Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813)
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma tissue using Anti-alpha smooth muscle Actin Antibody (A89813) at a dilution of 1:20 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813) - Antibodies.comBild Vergrößern
Figure 3: Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813)
Immunohistochemistry analysis of paraffin-embedded human esophagus using Anti-alpha smooth muscle Actin Antibody (A89813) at a dilution of 1:20 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813) - Antibodies.comBild Vergrößern
Figure 4: Immunohistochemistry - Anti-alpha smooth muscle Actin Antibody (A89813)
Immunohistochemistry analysis of paraffin-embedded human tonsil (negative control sample) using Anti-alpha smooth muscle Actin Antibody (A89813) at a dilution of 1:20 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Alternative Produkte zum Anti-alpha smooth muscle Actin Antikörper (A89813)

Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [1A4] (A249894) - Antibodies.com
(4)
A249894
Anti-alpha Smooth Muscle Actin Antikörper [1A4]
Monoklonal [1A4] Maus Antikörper gegen alpha Smooth Muscle Actin für Flow Cytometry, IF und IHC-P.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [1A4] - BSA and Azide free (A253074) - Antibodies.com
(4)
A253074
Anti-alpha Smooth Muscle Actin Antikörper [1A4]
Monoklonal [1A4] Maus Antikörper gegen alpha Smooth Muscle Actin für Flow Cytometry, IF und IHC-P.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [SPM332] (A249895) - Antibodies.com
(3)
A249895
Anti-alpha Smooth Muscle Actin Antikörper [SPM332]
Monoklonal [SPM332] Maus Antikörper gegen alpha Smooth Muscle Actin für IF und IHC-P.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [SPM332] - BSA and Azide free (A253075) - Antibodies.com
(3)
A253075
Anti-alpha Smooth Muscle Actin Antikörper [SPM332]
Monoklonal [SPM332] Maus Antikörper gegen alpha Smooth Muscle Actin für IF und IHC-P.
Antibodies.com Image Placeholder - Entdecken Sie mehr für weniger
A279072
Anti-alpha Smooth Muscle Actin Antikörper [1A4]
Monoklonal [1A4] Maus Antikörper gegen alpha Smooth Muscle Actin für WB, IHC-P, IHC-Fr, ELISA und IF.
Antibodies.com Image Placeholder - Entdecken Sie mehr für weniger
A115506
Anti-alpha Smooth Muscle Actin Antikörper [1A4]
Monoklonal [1A4] Maus Antikörper gegen alpha Smooth Muscle Actin für Electron microscopy, ICC, IHC-Fr, IHC-P und WB.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [ACTA2/791] (A249896) - Antibodies.com
(6)
A249896
Anti-alpha Smooth Muscle Actin Antikörper [ACTA2/791]
Monoklonal [ACTA2/791] Maus Antikörper gegen alpha Smooth Muscle Actin für Flow Cytometry, IF und IHC-P.
Antibodies.com Image Placeholder - Entdecken Sie mehr für weniger
A115508
Anti-alpha Smooth Muscle Actin Antikörper [HHF35]
Monoklonal [HHF35] Maus Antikörper gegen alpha Smooth Muscle Actin für Electron microscopy, ELISA, ICC, IHC-Fr, IHC-P und WB.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [1A4 + ACTA2/791] (A249897) - Antibodies.com
(6)
A249897
Anti-alpha Smooth Muscle Actin Antikörper [1A4 + ACTA2/791]
Oligoclonal [1A4 + ACTA2/791] Maus Antikörper gegen alpha Smooth Muscle Actin für Flow Cytometry, IF und IHC-P.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [ACTA2/791] - BSA and Azide free (A253076) - Antibodies.com
(6)
A253076
Anti-alpha Smooth Muscle Actin Antikörper [ACTA2/791]
Monoklonal [ACTA2/791] Maus Antikörper gegen alpha Smooth Muscle Actin für Flow Cytometry, IF und IHC-P.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [1A4 + ACTA2/791] - BSA and Azide free (A253077) - Antibodies.com
(6)
A253077
Anti-alpha Smooth Muscle Actin Antikörper [1A4 + ACTA2/791]
Oligoclonal [1A4 + ACTA2/791] Maus Antikörper gegen alpha Smooth Muscle Actin für Flow Cytometry, IF und IHC-P.
Western Blot - Anti-alpha smooth muscle Actin Antibody (A15615) - Antibodies.com
(3)
A15615
Anti-alpha smooth muscle Actin Antikörper
Polyklonal Kaninchen Antikörper gegen alpha smooth muscle Actin für WB und ICC/IF.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [1A4] (A249894) - Antibodies.com
(4)
A249894
Anti-alpha Smooth Muscle Actin Antikörper [1A4]
Monoklonal [1A4] Maus Antikörper gegen alpha Smooth Muscle Actin für Flow Cytometry, IF und IHC-P.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [1A4] - BSA and Azide free (A253074) - Antibodies.com
(4)
A253074
Anti-alpha Smooth Muscle Actin Antikörper [1A4]
Monoklonal [1A4] Maus Antikörper gegen alpha Smooth Muscle Actin für Flow Cytometry, IF und IHC-P.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [SPM332] (A249895) - Antibodies.com
(3)
A249895
Anti-alpha Smooth Muscle Actin Antikörper [SPM332]
Monoklonal [SPM332] Maus Antikörper gegen alpha Smooth Muscle Actin für IF und IHC-P.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [SPM332] - BSA and Azide free (A253075) - Antibodies.com
(3)
A253075
Anti-alpha Smooth Muscle Actin Antikörper [SPM332]
Monoklonal [SPM332] Maus Antikörper gegen alpha Smooth Muscle Actin für IF und IHC-P.
Antibodies.com Image Placeholder - Entdecken Sie mehr für weniger
A279072
Anti-alpha Smooth Muscle Actin Antikörper [1A4]
Monoklonal [1A4] Maus Antikörper gegen alpha Smooth Muscle Actin für WB, IHC-P, IHC-Fr, ELISA und IF.
Antibodies.com Image Placeholder - Entdecken Sie mehr für weniger
A115506
Anti-alpha Smooth Muscle Actin Antikörper [1A4]
Monoklonal [1A4] Maus Antikörper gegen alpha Smooth Muscle Actin für Electron microscopy, ICC, IHC-Fr, IHC-P und WB.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [ACTA2/791] (A249896) - Antibodies.com
(6)
A249896
Anti-alpha Smooth Muscle Actin Antikörper [ACTA2/791]
Monoklonal [ACTA2/791] Maus Antikörper gegen alpha Smooth Muscle Actin für Flow Cytometry, IF und IHC-P.
Antibodies.com Image Placeholder - Entdecken Sie mehr für weniger
A115508
Anti-alpha Smooth Muscle Actin Antikörper [HHF35]
Monoklonal [HHF35] Maus Antikörper gegen alpha Smooth Muscle Actin für Electron microscopy, ELISA, ICC, IHC-Fr, IHC-P und WB.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [1A4 + ACTA2/791] (A249897) - Antibodies.com
(6)
A249897
Anti-alpha Smooth Muscle Actin Antikörper [1A4 + ACTA2/791]
Oligoclonal [1A4 + ACTA2/791] Maus Antikörper gegen alpha Smooth Muscle Actin für Flow Cytometry, IF und IHC-P.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [ACTA2/791] - BSA and Azide free (A253076) - Antibodies.com
(6)
A253076
Anti-alpha Smooth Muscle Actin Antikörper [ACTA2/791]
Monoklonal [ACTA2/791] Maus Antikörper gegen alpha Smooth Muscle Actin für Flow Cytometry, IF und IHC-P.
Immunohistochemistry - Anti-alpha Smooth Muscle Actin Antibody [1A4 + ACTA2/791] - BSA and Azide free (A253077) - Antibodies.com
(6)
A253077
Anti-alpha Smooth Muscle Actin Antikörper [1A4 + ACTA2/791]
Oligoclonal [1A4 + ACTA2/791] Maus Antikörper gegen alpha Smooth Muscle Actin für Flow Cytometry, IF und IHC-P.
Western Blot - Anti-alpha smooth muscle Actin Antibody (A15615) - Antibodies.com
(3)
A15615
Anti-alpha smooth muscle Actin Antikörper
Polyklonal Kaninchen Antikörper gegen alpha smooth muscle Actin für WB und ICC/IF.
Alle Anti-alpha smooth muscle Actin Antikörper anzeigen
Hauptmenü Kontakt 0Kasse
Oben