Anti-Human IgG Antikörper [ARC53385] (A308177)

Name: Anti-Human IgG Antibody [ARC53385]
Brand: Antibodies.com
SKU: A308177

Bild Vergrößern

Dieses Produkt wurde eingestellt.

Anti-Human IgG Antikörper [ARC53385] (A308177) wurde eingestellt und ist nicht mehr verfügbar.

Alle Anti-Human IgG Antikörper anzeigen.

Produktdetails

Produktname

Anti-Human IgG Antibody [ARC53385]

Beschreibung

Rabbit monoclonal [ARC53385] antibody to Human IgG.

Anwendungen

WB, IHC, ICC/IF, Flow Cytometry

Verdünnungen

WB: 1:2,000-1:4,000, IHC: 1:500-1:1,000, Flow Cytometry: 1:50-1:200, ICC/IF: 1:50-1:200

Reaktivität

Human

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 100-330 of human Human IgG1 (Fc) (P01857).

Sequenz

PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Wirt

Rabbit

Klonalität

Monoclonal

Klon

ARC53385

Isotyp

IgG

Konjugat

Unconjugated

Reinigung

Affinity purification.

Produktform

Liquid

Formulierung

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.

Lagerung

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Synonyme

FLJ39988, FLJ40036, FLJ40253, FLJ40587, FLJ40789, FLJ40834, G1m marker, G2m marker, G3m marker, G4m marker, HDC, Heavy chain disease protein, Human immunglobulin G, Ig gamma 1 chain C region, Ig gamma 2 chain C region, Ig gamma 3 chain C region, Ig gamma 4 chain C region, IgG heavy chain locus, IGHG 1, IGHG 2, IGHG 3, IGHG 4, IGHG1, IGHG2, IGHG3, IGHG4, Immunoglobulin Gm1, Immunoglobulin Gm3, Immunoglobulin Gm4, Immunoglobulin heavy constant gamma 1, immunoglobulin heavy constant gamma 1 (G1m marker), Immunoglobulin heavy constant gamma 2, immunoglobulin heavy constant gamma 2 (G2m marker), Immunoglobulin heavy constant gamma 3, immunoglobulin heavy constant gamma 3 (G3m marker), Immunoglobulin heavy constant gamma 4, immunoglobulin heavy constant gamma 4 (G4m marker), MGC117419, MGC45809

Isotyp-Kontrollantikörper

Kompatible Sekundärantikörper

Haftungsausschluss

Dieses Produkt ist nur für Forschungszwecke bestimmt. Es ist nicht für diagnostische oder therapeutische Zwecke bestimmt.

Produktbilder (10)

Bild Vergrößern

Figure 1: Western Blot - Anti-Human IgG Antibody [ARC53385] (A308177)

Western blot analysis of extracts of 293T cells, using Anti-Human IgG Antibody [ARC53385] (A308177) at 1:4,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 30s.

Bild Vergrößern

Figure 2: Immunohistochemistry - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma tissue using Anti-Human IgG Antibody [ARC53385] (A308177) at a dilution of 1:1000(40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Bild Vergrößern

Figure 3: Immunohistochemistry - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunohistochemistry analysis of paraffin-embedded human brain (negative control sample) using Anti-Human IgG Antibody [ARC53385] (A308177) at a dilution of 1:1000(40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Bild Vergrößern

Figure 4: Immunohistochemistry - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunohistochemistry analysis of paraffin-embedded human tonsil using Anti-Human IgG Antibody [ARC53385] (A308177) at a dilution of 1:1000(40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Bild Vergrößern

Figure 5: Immunofluorescence - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunofluorescence analysis of 293F-IgG(FC) and 293F cells using Anti-human IgG Antibody [ARC53385] (A308177) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Bild Vergrößern

Figure 6: Immunofluorescence - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunofluorescence analysis of Daudi using Anti-human IgG Antibody [ARC53385] (A308177) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Bild Vergrößern

Figure 7: Immunofluorescence - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunofluorescence analysis of human tonsil using Anti-human IgG Antibody [ARC53385] (A308177) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Bild Vergrößern

Figure 8: Flow Cytometry - Anti-Human IgG Antibody [ARC53385] (A308177)

Flow cytometry analysis of Daudi cells, stained with Rabbit IgG isotype control (10 µg/ml, blue line) or Anti-Human IgG Antibody [ARC53385] (A308177), (10 µg/ml orange line), followed by Alexa Fluor 647 conjugated goat anti-rabbit polyclonal antibody (1:600 dilution) staining. Non-fluorescently stained Daudi cells, used as blank control (red line).

Bild Vergrößern

Figure 9: Flow Cytometry - Anti-Human IgG Antibody [ARC53385] (A308177)

Flow cytometry analysis of 293F(Transfection) cells, stained with Rabbit IgG isotype control (10 µg/ml, blue line) or Anti-Human IgG Antibody [ARC53385] (A308177), (10 µg/ml orange line), followed by Alexa Fluor 647 conjugated goat anti-rabbit polyclonal antibody (1:600 dilution) staining. Non-fluorescently stained 293F(Transfection) cells, used as blank control (red line).

Bild Vergrößern

Figure 10: Flow Cytometry - Anti-Human IgG Antibody [ARC53385] (A308177)

Flow cytometry analysis of 293F cells, stained with Rabbit IgG isotype control (10 µg/ml, blue line) or Anti-Human IgG Antibody [ARC53385] (A308177), (10 µg/ml orange line), followed by Alexa Fluor 647 conjugated goat anti-rabbit polyclonal antibody (1:600 dilution) staining. Non-fluorescently stained 293F cells, used as blank control (red line).

Zeige mehr Bilder