Anti-Integrin alpha 5 Antikörper [ARC0370] (A306223)

Name: Anti-Integrin alpha 5 Antibody [ARC0370]
Brand: Antibodies.com
SKU: A306223

Bild Vergrößern

Dieses Produkt wurde eingestellt.

Anti-Integrin alpha 5 Antikörper [ARC0370] (A306223) wurde eingestellt und ist nicht mehr verfügbar.

Alle Anti-Integrin alpha 5 Antikörper anzeigen.

Produktdetails

Produktname

Anti-Integrin alpha 5 Antibody [ARC0370]

Beschreibung

Rabbit monoclonal [ARC0370] antibody to Integrin alpha 5.

Anwendungen

WB, IHC, ICC/IF, IP, Flow Cytometry

Verdünnungen

WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200, IP: 1:500-1:1,000, Flow Cytometry: 1:50-1:200

Reaktivität

Human, Mouse, Rat

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 950-1049 of human Integrin alpha 5 (ITGA5/CD49e) (P08648).

Sequenz

HQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA

Wirt

Rabbit

Klonalität

Monoclonal

Klon

ARC0370

Isotyp

IgG

Konjugat

Unconjugated

Reinigung

Affinity purification.

Molekulargewicht

17 kDa / 150 kDa

Produktform

Liquid

Formulierung

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Lagerung

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Synonyme

CD49 antigen-like family member E, CD49e, Fibronectin receptor subunit alpha, Fibronectin receptor, alpha subunit, FNRA, Integrin alpha 5 (fibronectin receptor alpha), Integrin alpha-5, Integrin alpha-5 light chain, Integrin alpha-F, Integrin, alpha 5 (fibronectin receptor, alpha polypeptide), ITA5_HUMAN, Itga5, Very late activation protein 5, alpha subunit, VLA-5, VLA5, VLA5A

Isotyp-Kontrollantikörper

Kompatible Sekundärantikörper

Haftungsausschluss

Dieses Produkt ist nur für Forschungszwecke bestimmt. Es ist nicht für diagnostische oder therapeutische Zwecke bestimmt.

Produktbilder (9)

Bild Vergrößern

Figure 1: Western Blot - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Western blot analysis of extracts of A-549 cells, using Anti-Integrin alpha 5 Antibody [ARC0370] (A306223) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 1s.

Bild Vergrößern

Figure 2: Western Blot - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Western blot analysis of extracts of various cell lines, using Anti-Integrin alpha 5 Antibody [ARC0370] (A306223) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 10s.

Bild Vergrößern

Figure 3: Western Blot - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Bild Vergrößern

Figure 4: Immunohistochemistry - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Immunohistochemistry analysis of paraffin-embedded human placenta using Anti-Integrin alpha 5 Antibody [ARC0370] (A306223) at a dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Bild Vergrößern

Figure 5: Immunofluorescence - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Immunofluorescence analysis of rat colon using Anti-Integrin alpha 5 Antibody [ARC0370] (A306223) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Bild Vergrößern

Figure 6: Western Blot - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Immunoprecipitation analysis of 300µg extracts of A549 cells using 3µg of Anti-Integrin alpha 5 Antibody [ARC0370] (A306223). This Western blot was performed on the immunoprecipitate using Anti-Integrin alpha 5 Antibody [ARC0370] (A306223) at a dilution of 1:1000.

Bild Vergrößern

Figure 7: Flow Cytometry - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Flow cytometry analysis of K562 cells, stained with Rabbit IgG isotype control (5 µg/ml, blue line) or Anti-Integrin alpha 5 Antibody [ARC0370] (A306223), (5 µg/ml green line), followed by Alexa Fluor 647 conjugated goat anti-rabbit polyclonal antibody (1:600 dilution) staining. Non-fluorescently stained K562 cells, used as blank control (red line).

Bild Vergrößern

Figure 8: Flow Cytometry - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Flow cytometry analysis of U-87MG cells, stained with Rabbit IgG isotype control (5 µg/ml, blue line) or Anti-Integrin alpha 5 Antibody [ARC0370] (A306223), (5 µg/ml green line), followed by Alexa Fluor 647 conjugated goat anti-rabbit polyclonal antibody (1:600 dilution) staining. Non-fluorescently stained U-87MG cells, used as blank control (red line).

Bild Vergrößern

Figure 9: Flow Cytometry - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Flow cytometry analysis of Daudi cells, stained with Rabbit IgG isotype control (5 µg/ml, blue line) or Anti-Integrin alpha 5 Antibody [ARC0370] (A306223), 5 µg/ml green line), followed by Alexa Fluor 647 conjugated goat anti-rabbit polyclonal antibody (1:600 dilution) staining. Non-fluorescently stained Daudi cells, used as blank control (red line).

Zeige mehr Bilder