Anti-MCM2 Antikörper (A12998)

Anti-MCM2 Antibody

Rabbit polyclonal antibody to MCM2.

WB

WB: 1:500-1:2,000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 360-700 of human MCM2 (NP_004517.2).

PFEVNMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLNTANGFPVFATVILANHVAKKDNKVAVGELTDEDVKMITSLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGGEPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGS

Rabbit

Polyclonal

IgG

Unconjugated

130 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

BM28, CCNL 1, CCNL1, CDC like 1, cdc19, CDCL 1, CDCL1, Cell devision cycle like 1, Cyclin like 1, D3S3194, DNA replication licensing factor MCM2, KIAA0030, MCM 2, MCM2 minichromosome maintenance deficient 2 mitotin, MCM2 minichromosome maintenance deficient 2 mitotin (S. cerevisiae), MCM2 minichromosome maintenance deficient 2, mitotin, MCM2_HUMAN, MGC10606, Minichromosome maintenance complex component 2, Minichromosome maintenance deficient 2 (mitotin), Minichromosome maintenance deficient 2 mitotin, Minichromosome maintenance protein 2, Minichromosome maintenance protein 2 homolog, Mitotin, Nuclear protein BM28, OTTHUMP00000216047, OTTHUMP00000216050