Anti-p15 INK4b Antikörper (A14905)

Anti-p15 INK4b Antibody

Rabbit polyclonal antibody to p15 INK4b.

WB

WB: 1:500-1:1,000

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 59-138 of human CDKN2B (NP_004927.2).

ARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD

Rabbit

Polyclonal

IgG

Unconjugated

15 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

CDK inhibitory protein, CDK4B Inhibitor, Cdkn2b, CDN2B_HUMAN, Cyclin dependent kinase 4 inhibitor B, Cyclin Dependent Kinase Inhibitor 2B, Cyclin dependent kinase inhibitor 2B p15 inhibits CDK4, Cyclin dependent kinases 4 and 6 binding protein, Cyclin-dependent kinase 4 inhibitor B, INK4B, MTS 2, MTS-2, MTS2, Multiple tumor suppressor 2, Multiple Tumor Supressor 2, OTTHUMP00000021154, OTTHUMP00000021155, p14 CDK inhibitor, p14 INK4b, p14-INK4b, P15, p15 CDK inhibitor, p15 inhibits CDK4, p15 INK4b/CDKN2B, p15-INK4b, p15INK4B, TP 15, TP15