Anti-TLR4 Antikörper (A283238)

Anti-TLR4 Antibody

Goat polyclonal antibody to TLR4.

This antibody recognises the human Toll-like receptor 4, also known as CD284, hToll or TLR4. CD284 is an 839 amino acid ~96 kDa single pass type I transmembrane glycoprotein expressed by peripheral blood leucocytes, activated T cells, monocytes, macrophages, dendritic cells, granulocytes and endothelial cells. CD284 plays a primary role in the activation of innate immunity (UniProt: O00206).recognises an epitope within the N-terminal region of CD284, a highly conserved member of the toll-like receptor family which acts as a receptor for bacterial lipopolysaccharides (LPS) in co-operation with CD14 and MD2 (LY96), resulting in the activation of the MyD88-dependent and MyD88-independent (TRIF-dependent) signalling pathways and the production of inflammatory cytokines. LPS-activated CD284 can also induce dendritic cell maturation via TRIF-dependent signaling.Goat anti Human CD284 antibody is reported to be suitable for use in immunocytochemistry on acetone fixed cells.

WB, IHC-P

IHC-P 1: 1:100 - 1:300, WB: 1:500

Human, Mouse, Rat

Synthetic peptide sequence LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-terminus of human CD284.

LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC

Goat

Polyclonal

IgG

1 mg/ml

Liquid

Supplied in Phosphate Buffered Saline with 0.1% BSA and 0.1% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Goat anti Human CD284 antibody recognizes the human Toll-like receptor 4, also known as CD284, hToll or TLR4. CD284 is an 839 amino acid ~96 kDa single pass type I transmembrane glycoprotein expressed by peripheral blood leucocytes, activated T cells, monocytes, macrophages, dendritic cells, granulocytes and endothelial cells. CD284 plays a primary role in the activation of innate immunity (UniProt: O00206).Goat anti Human CD284 antibody recognizes an epitope within the N-terminal (NT) region of CD284, a highly conserved member of the toll-like receptor family which acts as a receptor for bacterial lipopolysaccharides (LPS) in co-operation with CD14 and MD2 (LY96), resulting in the activation of the MyD88-dependent and MyD88-independent (TRIF-dependent) signalling pathways and the production of inflammatory cytokines. LPS-activated CD284 can also induce dendritic cell maturation via TRIF-dependent signaling.Goat anti Human CD284 antibody is reported to be suitable for use in immunocytochemistry on acetone fixed cells.

ARMD10, CD284, CD284 antigen, Homolog of Drosophila toll, hToll, TLR 4, TLR4_HUMAN, TOLL, Toll like receptor 4, Toll-like receptor 4