Anti-UHRF1 Antikörper (A9042)

Anti-UHRF1 Antibody

Rabbit polyclonal antibody to UHRF1.

WB, IHC, ICC/IF

WB: 1:100-1:500, IHC: 1:50-1:200, ICC/IF: 1:20-1:50

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human UHRF1 (NP_001041666.1).

MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFDYEVRLNDTIQLLVRQSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSRPADEDMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVV

Rabbit

Polyclonal

IgG

Unconjugated

95 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Ac2-121, AL022808, E3 ubiquitin-protein ligase UHRF1, EC 6.3.2.-, FLJ21925, hNP95, hUHRF1, HuNp95, ICBP90, Inverted CCAAT box binding protein of 90 kDa, Inverted CCAAT box binding protein, 90-kD, Inverted CCAAT box-binding protein of 90 kDa, Liver regeneration-related protein LRRG126, MGC138707, NP95, Nuclear phosphoprotein 95, Nuclear phosphoprotein, 95-KD, Nuclear protein 95, Nuclear zinc finger protein Np95, RING finger protein 106, RNF106, TDRD22, Transcription factor ICBP90, Ubiquitin like containing PHD and RING finger domains protein 1, Ubiquitin like PHD and RING finger domain containing protein 1, Ubiquitin-like PHD and RING finger domain-containing protein 1, Ubiquitin-like protein containing PHD and RING finger domains 1, Ubiquitin-like with PHD and ring finger domains 1, Ubiquitin-like, containing PHD and RING finger domains, 1, Ubiquitin-like-containing PHD and RING finger domains protein 1, UHRF1_HUMAN