Anti-CD276 Anticorps [MJ18] (A281217)

Anti-CD276 Antibody [MJ18]

Rat monoclonal [MJ18] antibody to CD276.

This antibody recognises mouse CD276, otherwise known as B7-H3, a ubiquitously expressed transmembrane glycoprotein and member of the B7 family of co-stimulatory molecules, which acts as both a positive and negative regulator of T-cell-mediated immune responses.CD276 is highly expressed in bone during embryogenesis, and can be induced on dendritic cells and monocytes by inflammatory cytokines. CD276 has been implicated in the development of acute and chronic transplant rejection, and is reported to have therapeutic potential as a regulator of cell-mediated immune responses to cancer, particularly in conjunction with anti-angiogenic therapy. In mice, CD276 has been linked with the development of pathogenic Th2 cells during the induction phase of allergic asthma and have shown that Rat anti Mouse CD276 antibody, clone MJ18 inhibits stimulated CD4+ T-cell proliferation.

Flow Cytometry

Flow Cytometry: 1:25 - 1:200, Use 10µl of the suggested working dilution to label 1x10⁶ cells in 100µl.

Mouse

Mouse IgG2a Fc-CD276 amino acids 1-242.

MLRGWGGPSVGVCVRTALGVLCLCLTGAVEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPL

Rat

Monoclonal

MJ18

Unconjugated

Protein G affinity chromatography of tissue culture supernatant.

1 mg/ml

Liquid

Supplied in Phosphate Buffered Saline with 0.09% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Rat anti Mouse CD276 antibody, clone MJ18 specifically recognizes mouse CD276, otherwise known as B7-H3, a ubiquitously expressed transmembrane glycoprotein and member of the B7 family of co-stimulatory molecules, which acts as both a positive and negative regulator of T-cell-mediated immune responses.CD276 is highly expressed in bone during embryogenesis, and can be induced on dendritic cells and monocytes by inflammatory cytokines. CD276 has been implicated in the development of acute and chronic transplant rejection, and is reported to have therapeutic potential as a regulator of cell-mediated immune responses to cancer, particularly in conjunction with anti-angiogenic therapy. In mice, CD276 has been linked with the development of pathogenic Th2 cells during the induction phase of allergic asthma and have shown that Rat anti Mouse CD276 antibody, clone MJ18 inhibits stimulated CD4+ T-cell proliferation (Nagashima et al. 2008).

4Ig B7 H3, 4Ig-B7-H3, AU016588, B7 H3, B7 homolog 3, B7-H3, B7H3, B7RP-2, CD276 antigen, CD276 molecule, CD276_HUMAN, CD_antigen=CD276, Costimulatory molecule, Flags: Precursor, PSEC0249, UNQ309/PRO352