Anti-CD79a Anticorps [ARC51145] (A305911)

Anti-CD79a Antibody [ARC51145]

Rabbit monoclonal [ARC51145] antibody to CD79a.

WB, IHC, ICC/IF, Flow Cytometry

WB: 1:2,000-1:10,000, IHC: 1:2,000-1:20,000, ICC/IF: 1:50-1:200, Flow Cytometry: 1:50-1:200

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 165-225 of human CD79a (NP_001774.1).

FRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEK

Rabbit

Monoclonal

ARC51145

IgG

Affinity purification.

45 - 55 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

B lymphocyte-specific MB1 protein, B-cell antigen receptor complex-associated protein alpha chain, CD 79a, CD79A antigen, CD79a antigen (immunoglobulin-associated alpha), CD79a molecule, immunoglobulin-associated alpha, CD79A_HUMAN, Ig alpha, Ig-alpha, IGA, IgM-alpha, Immunoglobulin-associated alpha, Ly54, MB-1 membrane glycoprotein, MB1, Membrane-bound immunoglobulin-associated protein, Surface IgM-associated protein