Anti-Heme Oxygenase 1 Anticorps [ARC53508] (A307278)

Name: Anti-Heme Oxygenase 1 Antibody [ARC53508]
Brand: Antibodies.com
SKU: A307278
Price: 470.0 USD
Availability: InStock

Cliquez pour ouvrir le point de vue élargi

$470

Anticorps monoclonal [ARC53508] de lapin contre Heme Oxygenase 1 pour WB, IHC et IP.

Qualité 100 % Garantie

Garantie de Correspondance des Prix

Livraison

Frais de livraison

$40

Date de livraison

Livraison sous 5-8 jours ouvrables.

Nous ContacterContact

Téléphone

+1 (314) 370-6046

E-mail

orders@antibodies.com

Garanties

Qualité 100 % Garantie

Garantie de Correspondance des Prix

Mots clés :

Anticorps Validé par Knockout ER Marker

Spécifications

Nom du produit

Anti-Heme Oxygenase 1 Antibody [ARC53508]

Description du produit

Rabbit monoclonal [ARC53508] antibody to Heme Oxygenase 1.

Applications

WB, IHC, IP

Recommander des dilutions

WB: 1:2,000-1:10,000, IHC: 1:50-1:200, IP: 1:500-1:1,000

Reactivité

Human, Mouse, Rat

Immunogène

Recombinant fusion protein containing a sequence corresponding to amino acids 1-265 of human Heme Oxygenase 1 (HO-1/HMOX1) (NP_002124.1).

Séquence

MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQA

Hôte

Rabbit

Clonalité

Monoclonal

Clone

ARC53508

Isotype

IgG

Conjuguer

Unconjugated

Purification

Affinity purification.

Masse moléculaire

33 kDa

Forme du produit

Liquid

Formulation

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.

Stockage

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Synonymes

32 kD, bK286B10, D8Wsu38e, Heat shock protein, heat shock protein 32 kD, heat shock protein 32kD, Heme oxygenase (decycling) 1, Hemox, Hmox, HMOX 1, Hmox1, HMOX1_HUMAN, HO, HO 1, HO-1, HO1, Hsp32

Contrôles isotype

Anticorps secondaires appropriés

Avertissement

Ce produit est uniquement destiné à la recherche. Il n'est pas destiné à un usage diagnostique ou thérapeutique.

Images (10)

Cliquez pour ouvrir le point de vue élargi

Figure 1: Western Blot - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Western blot analysis of extracts of various cell lines, using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at 1:500 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 10s.

Cliquez pour ouvrir le point de vue élargi

Figure 2: Western Blot - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Western blot analysis of extracts of Raw264. 7 cells, using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at 1:10,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 3s.

Cliquez pour ouvrir le point de vue élargi

Figure 3: Western Blot - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Western blot analysis of extracts of HepG2 cells, using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at 1:10,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 180s.

Cliquez pour ouvrir le point de vue élargi

Figure 4: Western Blot - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Western blot analysis of extracts from wild type(WT) and Heme Oxygenase 1 (HO-1/HMOX1) knockout (KO) HeLa cells, using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at 1:10,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 180s.

Cliquez pour ouvrir le point de vue élargi

Figure 5: Immunohistochemistry - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Immunohistochemistry analysis of paraffin-embedded human liver using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at a dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 6: Immunohistochemistry - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Immunohistochemistry analysis of paraffin-embedded human lung using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at a dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 7: Immunohistochemistry - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Immunohistochemistry analysis of paraffin-embedded human tonsil using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at a dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 8: Immunohistochemistry - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Immunohistochemistry analysis of paraffin-embedded mouse liver using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at a dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 9: Immunohistochemistry - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Immunohistochemistry analysis of paraffin-embedded rat lung using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at a dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 10: Western Blot - Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278)

Immunoprecipitation analysis of 300µg extracts of HepG2 cells using 3µg of Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278). This Western blot was performed on the immunoprecipitate using Anti-Heme Oxygenase 1 Antibody [ARC53508] (A307278) at a dilution of 1:1000.

Voir plus de photos