Anti-Humain IgG Anticorps [ARC53385] (A308177)

Name: Anti-Human IgG Antibody [ARC53385]
Brand: Antibodies.com
SKU: A308177

Cliquez pour ouvrir le point de vue élargi

Ce produit est discontinué

Anti-Humain IgG Anticorps [ARC53385] (A308177) a été abandonné et n'est plus disponible.

Voir toutes Anti-Human IgG Anticorps.

Spécifications

Nom du produit

Anti-Human IgG Antibody [ARC53385]

Description du produit

Rabbit monoclonal [ARC53385] antibody to Human IgG.

Applications

WB, IHC, ICC/IF, Flow Cytometry

Recommander des dilutions

WB: 1:2,000-1:4,000, IHC: 1:500-1:1,000, Flow Cytometry: 1:50-1:200, ICC/IF: 1:50-1:200

Reactivité

Human

Immunogène

Recombinant fusion protein containing a sequence corresponding to amino acids 100-330 of human Human IgG1 (Fc) (P01857).

Séquence

PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Hôte

Rabbit

Clonalité

Monoclonal

Clone

ARC53385

Isotype

IgG

Conjuguer

Unconjugated

Purification

Affinity purification.

Forme du produit

Liquid

Formulation

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.

Stockage

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Synonymes

FLJ39988, FLJ40036, FLJ40253, FLJ40587, FLJ40789, FLJ40834, G1m marker, G2m marker, G3m marker, G4m marker, HDC, Heavy chain disease protein, Human immunglobulin G, Ig gamma 1 chain C region, Ig gamma 2 chain C region, Ig gamma 3 chain C region, Ig gamma 4 chain C region, IgG heavy chain locus, IGHG 1, IGHG 2, IGHG 3, IGHG 4, IGHG1, IGHG2, IGHG3, IGHG4, Immunoglobulin Gm1, Immunoglobulin Gm3, Immunoglobulin Gm4, Immunoglobulin heavy constant gamma 1, immunoglobulin heavy constant gamma 1 (G1m marker), Immunoglobulin heavy constant gamma 2, immunoglobulin heavy constant gamma 2 (G2m marker), Immunoglobulin heavy constant gamma 3, immunoglobulin heavy constant gamma 3 (G3m marker), Immunoglobulin heavy constant gamma 4, immunoglobulin heavy constant gamma 4 (G4m marker), MGC117419, MGC45809

Contrôles isotype

Anticorps secondaires appropriés

Avertissement

Ce produit est uniquement destiné à la recherche. Il n'est pas destiné à un usage diagnostique ou thérapeutique.

Images (10)

Cliquez pour ouvrir le point de vue élargi

Figure 1: Western Blot - Anti-Human IgG Antibody [ARC53385] (A308177)

Western blot analysis of extracts of 293T cells, using Anti-Human IgG Antibody [ARC53385] (A308177) at 1:4,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 30s.

Cliquez pour ouvrir le point de vue élargi

Figure 2: Immunohistochemistry - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma tissue using Anti-Human IgG Antibody [ARC53385] (A308177) at a dilution of 1:1000(40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 3: Immunohistochemistry - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunohistochemistry analysis of paraffin-embedded human brain (negative control sample) using Anti-Human IgG Antibody [ARC53385] (A308177) at a dilution of 1:1000(40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 4: Immunohistochemistry - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunohistochemistry analysis of paraffin-embedded human tonsil using Anti-Human IgG Antibody [ARC53385] (A308177) at a dilution of 1:1000(40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 5: Immunofluorescence - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunofluorescence analysis of 293F-IgG(FC) and 293F cells using Anti-human IgG Antibody [ARC53385] (A308177) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Cliquez pour ouvrir le point de vue élargi

Figure 6: Immunofluorescence - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunofluorescence analysis of Daudi using Anti-human IgG Antibody [ARC53385] (A308177) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Cliquez pour ouvrir le point de vue élargi

Figure 7: Immunofluorescence - Anti-Human IgG Antibody [ARC53385] (A308177)

Immunofluorescence analysis of human tonsil using Anti-human IgG Antibody [ARC53385] (A308177) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Cliquez pour ouvrir le point de vue élargi

Figure 8: Flow Cytometry - Anti-Human IgG Antibody [ARC53385] (A308177)

Flow cytometry analysis of Daudi cells, stained with Rabbit IgG isotype control (10 µg/ml, blue line) or Anti-Human IgG Antibody [ARC53385] (A308177), (10 µg/ml orange line), followed by Alexa Fluor 647 conjugated goat anti-rabbit polyclonal antibody (1:600 dilution) staining. Non-fluorescently stained Daudi cells, used as blank control (red line).

Cliquez pour ouvrir le point de vue élargi

Figure 9: Flow Cytometry - Anti-Human IgG Antibody [ARC53385] (A308177)

Flow cytometry analysis of 293F(Transfection) cells, stained with Rabbit IgG isotype control (10 µg/ml, blue line) or Anti-Human IgG Antibody [ARC53385] (A308177), (10 µg/ml orange line), followed by Alexa Fluor 647 conjugated goat anti-rabbit polyclonal antibody (1:600 dilution) staining. Non-fluorescently stained 293F(Transfection) cells, used as blank control (red line).

Cliquez pour ouvrir le point de vue élargi

Figure 10: Flow Cytometry - Anti-Human IgG Antibody [ARC53385] (A308177)

Flow cytometry analysis of 293F cells, stained with Rabbit IgG isotype control (10 µg/ml, blue line) or Anti-Human IgG Antibody [ARC53385] (A308177), (10 µg/ml orange line), followed by Alexa Fluor 647 conjugated goat anti-rabbit polyclonal antibody (1:600 dilution) staining. Non-fluorescently stained 293F cells, used as blank control (red line).

Voir plus de photos