Anti-Integrin alpha 5 Anticorps [ARC0370] (A306223)

Name: Anti-Integrin alpha 5 Antibody [ARC0370]
Brand: Antibodies.com
SKU: A306223

Cliquez pour ouvrir le point de vue élargi

Ce produit est discontinué

Anti-Integrin alpha 5 Anticorps [ARC0370] (A306223) a été abandonné et n'est plus disponible.

Voir toutes Anti-Integrin alpha 5 Anticorps.

Spécifications

Nom du produit

Anti-Integrin alpha 5 Antibody [ARC0370]

Description du produit

Rabbit monoclonal [ARC0370] antibody to Integrin alpha 5.

Applications

WB, IHC, ICC/IF, IP, Flow Cytometry

Recommander des dilutions

WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200, IP: 1:500-1:1,000, Flow Cytometry: 1:50-1:200

Reactivité

Human, Mouse, Rat

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 950-1049 of human Integrin alpha 5 (ITGA5/CD49e) (P08648).

Séquence

HQPFSLQCEAVYKALKMPYRILPRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA

Hôte

Rabbit

Clonalité

Monoclonal

Clone

ARC0370

Isotype

IgG

Conjuguer

Unconjugated

Purification

Affinity purification.

Masse moléculaire

17 kDa / 150 kDa

Forme du produit

Liquid

Formulation

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Stockage

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Synonymes

CD49 antigen-like family member E, CD49e, Fibronectin receptor subunit alpha, Fibronectin receptor, alpha subunit, FNRA, Integrin alpha 5 (fibronectin receptor alpha), Integrin alpha-5, Integrin alpha-5 light chain, Integrin alpha-F, Integrin, alpha 5 (fibronectin receptor, alpha polypeptide), ITA5_HUMAN, Itga5, Very late activation protein 5, alpha subunit, VLA-5, VLA5, VLA5A

Contrôles isotype

Anticorps secondaires appropriés

Avertissement

Ce produit est uniquement destiné à la recherche. Il n'est pas destiné à un usage diagnostique ou thérapeutique.

Images (9)

Cliquez pour ouvrir le point de vue élargi

Figure 1: Western Blot - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Western blot analysis of extracts of A-549 cells, using Anti-Integrin alpha 5 Antibody [ARC0370] (A306223) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 1s.

Cliquez pour ouvrir le point de vue élargi

Figure 2: Western Blot - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Western blot analysis of extracts of various cell lines, using Anti-Integrin alpha 5 Antibody [ARC0370] (A306223) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 10s.

Cliquez pour ouvrir le point de vue élargi

Figure 3: Western Blot - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Cliquez pour ouvrir le point de vue élargi

Figure 4: Immunohistochemistry - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Immunohistochemistry analysis of paraffin-embedded human placenta using Anti-Integrin alpha 5 Antibody [ARC0370] (A306223) at a dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 5: Immunofluorescence - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Immunofluorescence analysis of rat colon using Anti-Integrin alpha 5 Antibody [ARC0370] (A306223) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Cliquez pour ouvrir le point de vue élargi

Figure 6: Western Blot - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Immunoprecipitation analysis of 300µg extracts of A549 cells using 3µg of Anti-Integrin alpha 5 Antibody [ARC0370] (A306223). This Western blot was performed on the immunoprecipitate using Anti-Integrin alpha 5 Antibody [ARC0370] (A306223) at a dilution of 1:1000.

Cliquez pour ouvrir le point de vue élargi

Figure 7: Flow Cytometry - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Flow cytometry analysis of K562 cells, stained with Rabbit IgG isotype control (5 µg/ml, blue line) or Anti-Integrin alpha 5 Antibody [ARC0370] (A306223), (5 µg/ml green line), followed by Alexa Fluor 647 conjugated goat anti-rabbit polyclonal antibody (1:600 dilution) staining. Non-fluorescently stained K562 cells, used as blank control (red line).

Cliquez pour ouvrir le point de vue élargi

Figure 8: Flow Cytometry - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Flow cytometry analysis of U-87MG cells, stained with Rabbit IgG isotype control (5 µg/ml, blue line) or Anti-Integrin alpha 5 Antibody [ARC0370] (A306223), (5 µg/ml green line), followed by Alexa Fluor 647 conjugated goat anti-rabbit polyclonal antibody (1:600 dilution) staining. Non-fluorescently stained U-87MG cells, used as blank control (red line).

Cliquez pour ouvrir le point de vue élargi

Figure 9: Flow Cytometry - Anti-Integrin alpha 5 Antibody [ARC0370] (A306223)

Flow cytometry analysis of Daudi cells, stained with Rabbit IgG isotype control (5 µg/ml, blue line) or Anti-Integrin alpha 5 Antibody [ARC0370] (A306223), 5 µg/ml green line), followed by Alexa Fluor 647 conjugated goat anti-rabbit polyclonal antibody (1:600 dilution) staining. Non-fluorescently stained Daudi cells, used as blank control (red line).

Voir plus de photos