Anti-KLF10 Anticorps [ARC1921] (A307511)

Anti-KLF10 Antibody [ARC1921]

Rabbit monoclonal [ARC1921] antibody to KLF10.

WB

WB: 1:500-1:2,000

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KLF10 (Q13118).

MLNFGASLQQTAEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSDLSEEENLLPGTPDFHTIPAFCLTPPYSPSD

Rabbit

Monoclonal

ARC1921

IgG

Unconjugated

53 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Early growth response, alpha, Early growth response, alpha like, EGR A, EGR alpha, EGR(A), EGR-alpha, EGRA, Egral, EGRalpha, Gdnfif, KLF 10, KLF10_HUMAN, Krueppel like factor 10, Krueppel like factor10, Krueppel-like factor 10, Kruppel like factor 10, mGIF, TGF-beta- inducible early gene, TGFB inducible early growth response, TGFB inducible early growth response 1, TGFB inducible early growth response protein 1, TGFB-inducible early growth response protein 1, TIEG, TIEG 1, TIEG-1, TIEG1, Transforming growth factor beta inducible early growth response, Transforming growth factor beta inducible early growth response protein 1, Transforming growth factor-beta-inducible early growth response protein 1, Zinc finger transcription factor TIEG