LR3 IGF1 Humain (A63220)

LR3 IGF1 Human

LR3 Insulin Like Growth Factor-1 Human Recombinant

Escherichia Coli.

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA.

Sterile Filtered White lyophilized (freeze-dried) powder.

Lyophilized from a 0.2µm filtered concentrated solution in 1xPBS.

Lyophilized LR3 IGF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution the LR3 IGF1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.

Ce produit est uniquement destiné à la recherche. Il n'est pas destiné à un usage diagnostique ou thérapeutique.