Anti-PGC1 alpha Anticorps [ARC51988] (A308321)

Name: Anti-PGC1 alpha Antibody [ARC51988]
Brand: Antibodies.com
SKU: A308321

Cliquez pour ouvrir le point de vue élargi

Ce produit est discontinué

Anti-PGC1 alpha Anticorps [ARC51988] (A308321) a été abandonné et n'est plus disponible.

Voir toutes Anti-PGC1 alpha Anticorps.

Spécifications

Nom du produit

Anti-PGC1 alpha Antibody [ARC51988]

Description du produit

Rabbit monoclonal [ARC51988] antibody to PGC1 alpha.

Applications

WB, IHC

Recommander des dilutions

WB: 1:500-1:1,000, IHC: 1:500-1:1,000

Reactivité

Human, Mouse, Rat

Immunogène

Recombinant fusion protein containing a sequence corresponding to amino acids 340-480 of human PGC1a (NP_037393.1).

Séquence

QGNNSTKKGPEQSELYAQLSKSSVLTGGHEERKTKRPSLRLFGDHDYCQSINSKTEILINISQELQDSRQLENKDVSSDWQGQICSSTDSDQCYLRETLEASKQVSPCSTRKQLQDQEIRAELNKHFGHPSQAVFDDEADK

Hôte

Rabbit

Clonalité

Monoclonal

Clone

ARC51988

Isotype

IgG

Conjuguer

Unconjugated

Purification

Affinity purification.

Masse moléculaire

100 kDa

Forme du produit

Liquid

Formulation

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.

Stockage

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Synonymes

L PGC 1alpha, LEM6, Ligand effect modulator 6, Peroxisome proliferative activated receptor gamma coactivator 1, Peroxisome proliferative activated receptor gamma coactivator 1 alpha, Peroxisome proliferator activated receptor gamma coactivator 1 alpha, Peroxisome proliferator activated receptor gamma coactivator 1 alpha transcript variant B4, Peroxisome proliferator activated receptor gamma coactivator 1 alpha transcript variant B4 3ext, Peroxisome proliferator activated receptor gamma coactivator 1 alpha transcript variant B4 8a, Peroxisome proliferator activated receptor gamma coactivator 1 alpha transcript variant B5, Peroxisome proliferator activated receptor gamma coactivator 1 alpha transcript variant B5 NT, Peroxisome proliferator-activated receptor gamma coactivator 1-alpha, PGC 1 (alpha), PGC 1 alpha, PGC 1v, PGC-1-alpha, PGC1, PGC1(alpha), PGC1A, PGC1v, PPAR gamma coactivator 1, PPAR gamma coactivator 1 alpha, PPAR gamma coactivator 1 alpha 3 ligand effect modulator 6, PPAR gamma coactivator variant form, PPAR-gamma coactivator 1-alpha, PPARGC 1 alpha, PPARGC-1-alpha, PPARGC1, PPARGC1A, PRGC1_HUMAN

Contrôles isotype

Anticorps secondaires appropriés

Avertissement

Ce produit est uniquement destiné à la recherche. Il n'est pas destiné à un usage diagnostique ou thérapeutique.

Images (4)

Cliquez pour ouvrir le point de vue élargi

Figure 1: Western Blot - Anti-PGC1 alpha Antibody [ARC51988] (A308321)

Western blot analysis of extracts of various cell lines, using Anti-PGC1 alpha Antibody [ARC51988] (A308321) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 30s.

Cliquez pour ouvrir le point de vue élargi

Figure 2: Immunohistochemistry - Anti-PGC1 alpha Antibody [ARC51988] (A308321)

Immunohistochemistry analysis of paraffin-embedded human colon carcinoma tissue using Anti-PGC1 alpha Antibody [ARC51988] (A308321) at a dilution of 1:1000(40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 3: Immunohistochemistry - Anti-PGC1 alpha Antibody [ARC51988] (A308321)

Immunohistochemistry analysis of paraffin-embedded rat heart using Anti-PGC1 alpha Antibody [ARC51988] (A308321) at a dilution of 1:1000(40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 4: Immunohistochemistry - Anti-PGC1 alpha Antibody [ARC51988] (A308321)

Immunohistochemistry analysis of paraffin-embedded rat kidney using Anti-PGC1 alpha Antibody [ARC51988] (A308321) at a dilution of 1:1000(40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.