Anti-RBM3 Anticorps [ARC2882] (A305721)

Name: Anti-RBM3 Antibody [ARC2882]
Brand: Antibodies.com
SKU: A305721

Cliquez pour ouvrir le point de vue élargi

Ce produit est discontinué

Anti-RBM3 Anticorps [ARC2882] (A305721) a été abandonné et n'est plus disponible.

Voir toutes Anti-RBM3 Anticorps.

Spécifications

Nom du produit

Anti-RBM3 Antibody [ARC2882]

Description du produit

Rabbit monoclonal [ARC2882] antibody to RBM3.

Applications

WB, IHC, ICC/IF

Recommander des dilutions

WB: 1:100-1:500, IHC: 1:50-1:200, ICC/IF: 1:50-1:200

Reactivité

Human, Mouse, Rat

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 58-157 of human RBM3 (P98179).

Séquence

EHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN

Hôte

Rabbit

Clonalité

Monoclonal

Clone

ARC2882

Isotype

IgG

Conjuguer

Unconjugated

Purification

Affinity purification.

Masse moléculaire

17 kDa

Forme du produit

Liquid

Formulation

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Stockage

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Synonymes

2600016C11Rik, IS1 RNPL, MGC105811, MGC118410, OTTHUMP00000025800, OTTHUMP00000025802, OTTMUSP00000019634, OTTMUSP00000019635, OTTMUSP00000019636, Putative RNA binding protein 3, Putative RNA-binding protein 3, RBM3_HUMAN, RNA binding motif (RNP1, RRM) protein 3, RNA binding motif protein 3, RNA-binding motif protein 3, RNA-binding protein 3, RNPL, RP23-27I6.7

Contrôles isotype

Anticorps secondaires appropriés

Avertissement

Ce produit est uniquement destiné à la recherche. Il n'est pas destiné à un usage diagnostique ou thérapeutique.

Images (10)

Cliquez pour ouvrir le point de vue élargi

Figure 1: Western Blot - Anti-RBM3 Antibody [ARC2882] (A305721)

Western blot analysis of extracts of various cell lines, using Anti-RBM3 Antibody [ARC2882] (A305721) at 1:500 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 30s.

Cliquez pour ouvrir le point de vue élargi

Figure 2: Immunohistochemistry - Anti-RBM3 Antibody [ARC2882] (A305721)

Immunohistochemistry analysis of paraffin-embedded human lung cancer using Anti-RBM3 Antibody [ARC2882] (A305721) at a dilution of 1:20 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 3: Immunohistochemistry - Anti-RBM3 Antibody [ARC2882] (A305721)

Immunohistochemistry analysis of paraffin-embedded human placenta using Anti-RBM3 Antibody [ARC2882] (A305721) at a dilution of 1:20 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 4: Immunohistochemistry - Anti-RBM3 Antibody [ARC2882] (A305721)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using Anti-RBM3 Antibody [ARC2882] (A305721) at a dilution of 1:20 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 5: Immunohistochemistry - Anti-RBM3 Antibody [ARC2882] (A305721)

Immunohistochemistry analysis of paraffin-embedded mouse liver using Anti-RBM3 Antibody [ARC2882] (A305721) at a dilution of 1:20 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 6: Immunohistochemistry - Anti-RBM3 Antibody [ARC2882] (A305721)

Immunohistochemistry analysis of paraffin-embedded rat liver using Anti-RBM3 Antibody [ARC2882] (A305721) at a dilution of 1:20 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 7: Immunohistochemistry - Anti-RBM3 Antibody [ARC2882] (A305721)

Immunohistochemistry analysis of paraffin-embedded rat ovary using Anti-RBM3 Antibody [ARC2882] (A305721) at a dilution of 1:20 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 8: Immunofluorescence - Anti-RBM3 Antibody [ARC2882] (A305721)

Immunofluorescence analysis of HeLa cells using Anti-RBM3 Antibody [ARC2882] (A305721) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Cliquez pour ouvrir le point de vue élargi

Figure 9: Immunofluorescence - Anti-RBM3 Antibody [ARC2882] (A305721)

Immunofluorescence analysis of NIH/3T3 cells using Anti-RBM3 Antibody [ARC2882] (A305721) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Cliquez pour ouvrir le point de vue élargi

Figure 10: Immunofluorescence - Anti-RBM3 Antibody [ARC2882] (A305721)

Immunofluorescence analysis of PC-12 cells using Anti-RBM3 Antibody [ARC2882] (A305721) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Voir plus de photos