Anti-YAP1 Anticorps [ARC53477] (A308258)

Name: Anti-YAP1 Antibody [ARC53477]
Brand: Antibodies.com
SKU: A308258
Price: 470.0 USD
Availability: InStock

Cliquez pour ouvrir le point de vue élargi

$470

Anticorps monoclonal [ARC53477] de lapin contre YAP1 pour WB, IHC, ICC/IF et IP.

Qualité 100 % Garantie

Garantie de Correspondance des Prix

Livraison

Frais de livraison

$40

Date de livraison

Livraison sous 5-8 jours ouvrables.

Nous ContacterContact

Téléphone

+1 (314) 370-6046

E-mail

orders@antibodies.com

Garanties

Qualité 100 % Garantie

Garantie de Correspondance des Prix

Mots clés :

Anticorps Validé par Knockout

Spécifications

Nom du produit

Anti-YAP1 Antibody [ARC53477]

Description du produit

Rabbit monoclonal [ARC53477] antibody to YAP1.

Applications

WB, IHC, ICC/IF, IP

Recommander des dilutions

WB: 1:2,000-1:4,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200, IP: 1:100-1:500

Reactivité

Human, Mouse, Rat

Immunogène

Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1).

Séquence

PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

Hôte

Rabbit

Clonalité

Monoclonal

Clone

ARC53477

Isotype

IgG

Conjuguer

Unconjugated

Purification

Affinity purification.

Masse moléculaire

72 kDa

Forme du produit

Liquid

Formulation

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.05% Proclin 300.

Stockage

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Synonymes

65 kDa Yes associated protein, 65 kDa Yes-associated protein, COB1, YAP, YAp 1, YAP 65, YAP1_HUMAN, YAP2, YAP65, yes -associated protein delta, Yes associated protein 1, Yes associated protein 1 65kDa, Yes associated protein 2, yes associated protein beta, YKI, Yorkie homolog

Contrôles isotype

Anticorps secondaires appropriés

Avertissement

Ce produit est uniquement destiné à la recherche. Il n'est pas destiné à un usage diagnostique ou thérapeutique.

Images (11)

Cliquez pour ouvrir le point de vue élargi

Figure 1: Western Blot - Anti-YAP1 Antibody [ARC53477] (A308258)

Western blot analysis of extracts of C6 cells, using Anti-YAP1 Antibody [ARC53477] (A308258) at 1:4,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 1s.

Cliquez pour ouvrir le point de vue élargi

Figure 2: Western Blot - Anti-YAP1 Antibody [ARC53477] (A308258)

Western blot analysis of extracts of Mouse heart, using Anti-YAP1 Antibody [ARC53477] (A308258) at 1:4,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 20s.

Cliquez pour ouvrir le point de vue élargi

Figure 3: Western Blot - Anti-YAP1 Antibody [ARC53477] (A308258)

Western blot analysis of extracts from wild type(WT) and YAP1 knockout (KO) HeLa cells, using Anti-YAP1 Antibody [ARC53477] (A308258) at 1:4,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 1s.

Cliquez pour ouvrir le point de vue élargi

Figure 4: Immunohistochemistry - Anti-YAP1 Antibody [ARC53477] (A308258)

Immunohistochemistry analysis of paraffin-embedded human liver (negative control sample) using Anti-YAP1 Antibody [ARC53477] (A308258) at a dilution of 1:200(40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Cliquez pour ouvrir le point de vue élargi

Figure 5: Immunohistochemistry - Anti-YAP1 Antibody [ARC53477] (A308258)

Cliquez pour ouvrir le point de vue élargi

Figure 6: Immunohistochemistry - Anti-YAP1 Antibody [ARC53477] (A308258)

Cliquez pour ouvrir le point de vue élargi

Figure 7: Immunohistochemistry - Anti-YAP1 Antibody [ARC53477] (A308258)

Cliquez pour ouvrir le point de vue élargi

Figure 8: Immunofluorescence - Anti-YAP1 Antibody [ARC53477] (A308258)

Immunofluorescence analysis of NIH/3T3 cells using Anti-YAP1 Antibody [ARC53477] (A308258) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Cliquez pour ouvrir le point de vue élargi

Figure 9: Immunofluorescence - Anti-YAP1 Antibody [ARC53477] (A308258)

Immunofluorescence analysis of U20S cells using Anti-YAP1 Antibody [ARC53477] (A308258) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Cliquez pour ouvrir le point de vue élargi

Figure 10: Immunofluorescence - Anti-YAP1 Antibody [ARC53477] (A308258)

Immunofluorescence analysis of HeLa cells using Anti-YAP1 Antibody [ARC53477] (A308258) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).

Cliquez pour ouvrir le point de vue élargi

Figure 11: Western Blot - Anti-YAP1 Antibody [ARC53477] (A308258)

Immunoprecipitation analysis of 300µg extracts of A-549 cells using 3µg of Anti-YAP1 Antibody [ARC53477] (A308258). This Western blot was performed on the immunoprecipitate using Anti-YAP1 Antibody [ARC53477] (A308258) at a dilution of 1:500.

Voir plus de photos

Produits alternatifs à Anti-YAP1 Anticorps [ARC53477] (A308258)

(5)

A16747

Anti-YAP1 Anticorps [ARC53477] (A308258)

Anticorps monoclonal [ARC53477] de lapin contre YAP1 pour WB, IHC, ICC/IF et IP.

Informations sur la Livraison

Livraison

Nous ContacterContact

Garanties

Produits alternatifs à Anti-YAP1 Anticorps [ARC53477] (A308258)