Anti-Histone H3 Anticorps (A88523)

Anticorps polyclonal de lapin contre Histone H3 pour WB, IHC, IP et ChIP.

Frais de livraison
Date de livraison
Livraison sous 5-8 jours ouvrables.
Téléphone
+1 (314) 370-6046
Lun - Ven, 8h - 16h AST
E-mail
orders@antibodies.com

Produits recommandés pour Anti-Histone H3 Anticorps

Nom du produit
Anti-Histone H3 Antibody
Description du produit
Rabbit polyclonal antibody to Histone H3.
Applications
WB, IHC, IP, ChIP
Recommander des dilutions
WB: 1:2,000-1:10,000, IHC: 1:50-1:200, IP: 1:50-1:200, ChIP: 1:50-1:200
Reactivité
Human, Mouse, Rat
Immunogène
A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human HIST3H3 (NP_003484.1).
Séquence
REIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA
Hôte
Rabbit
Clonalité
Polyclonal
Isotype
IgG
Conjuguer

Unconjugated

Purification
Affinity purification.
Masse moléculaire
17 kDa
Forme du produit
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Stockage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonymes
Cit Histone H3, Citrullated, citrullin, Citrullinated Histone H3, citrulline, FLJ92264, H 3, H3, H3 3 like sequence MH921, H3 3A, H3 a, H3 b, H3 c, H3 d, H3 f, H3 h, H3 histone, H3 histone family member E pseudogene, H3 histone family, member A, H3 histone family, member B, H3 histone family, member C, H3 histone family, member D, H3 histone family, member F, H3 histone family, member H, H3 histone family, member I, H3 histone family, member J, H3 histone family, member K, H3 histone family, member L, H3 histone family, member T, H3 histone, family 3A, H3 i, H3 j, H3 k, H3 l, H3.1, H3.3A, H3/A, H3/b, H3/c, H3/d, h3/f, H3/h, H3/i, H3/j, H3/k, H3/l, H3/t, H31_HUMAN, H33_HUMAN, H3F1K, H3F3, H3F3A, H3f3b, H3FA, H3FB, H3FC, H3FD, H3FF, H3FH, H3FI, H3FJ, H3FK, H3FL, HIST1 cluster, H3A, HIST1 cluster, H3B, HIST1 cluster, H3C, HIST1 cluster, H3D, HIST1 cluster, H3E, HIST1 cluster, H3F, HIST1 cluster, H3G, HIST1 cluster, H3H, HIST1 cluster, H3I, HIST1 cluster, H3J, Hist1h3a, HIST1H3B, HIST1H3C, HIST1H3D, HIST1H3E, HIST1H3F, HIST1H3G, HIST1H3H, HIST1H3I, HIST1H3J, HIST3H3, HIST3HA, histone 1, H3a, Histone 1, H3b, Histone 1, H3c, Histone 1, H3d, Histone 1, H3e, Histone 1, H3f, Histone 1, H3g, Histone 1, H3h, Histone 1, H3i, Histone 1, H3j, Histone 3, H3, histone cluster 1 H3 family member a, histone cluster 1 H3 family member b, histone cluster 1 H3 family member c, histone cluster 1 H3 family member d, histone cluster 1 H3 family member e, histone cluster 1 H3 family member f, histone cluster 1 H3 family member g, histone cluster 1 H3 family member h, histone cluster 1 H3 family member i, histone cluster 1 H3 family member j, Histone cluster 1, H3a, Histone cluster 1, H3b, Histone cluster 1, H3c, Histone cluster 1, H3d, Histone cluster 1, H3e, Histone cluster 1, H3f, Histone cluster 1, H3g, Histone cluster 1, H3i, Histone cluster 1, H3j, Histone gene cluster 1, H3 histone family, member A, Histone gene cluster 1, H3 histone family, member B, Histone gene cluster 1, H3 histone family, member C, Histone gene cluster 1, H3 histone family, member D, Histone gene cluster 1, H3 histone family, member E, Histone gene cluster 1, H3 histone family, member F, Histone gene cluster 1, H3 histone family, member G, Histone gene cluster 1, H3 histone family, member H, Histone gene cluster 1, H3 histone family, member I, Histone gene cluster 1, H3 histone family, member J, Histone gene cluster 1, H3A, Histone gene cluster 1, H3B, Histone gene cluster 1, H3C, Histone gene cluster 1, H3D, Histone gene cluster 1, H3E, Histone gene cluster 1, H3F, Histone gene cluster 1, H3G, Histone gene cluster 1, H3H, Histone gene cluster 1, H3I, Histone gene cluster 1, H3J, Histone H 3, Histone H3 3 pseudogene, Histone H3 Citrullated, Histone H3.1, Histone H3.1t, Histone H3.2, Histone H3.3, Histone H3.3C, Histone H3.5, Histone H3/a, Histone H3/b, Histone H3/c, Histone H3/d, Histone H3/f, Histone H3/h, Histone H3/i, Histone H3/j, Histone H3/k, Histone H3/l, Histone H3/m, Histone H3/o
Avertissement
Ce produit est uniquement destiné à la recherche. Il n'est pas destiné à un usage diagnostique ou thérapeutique.

Produits alternatifs à Anti-Histone H3 Anticorps (A88523)

Haut