Anti-Histone H4 Anticorps (A13282)

Anticorps polyclonal de lapin contre Histone H4 pour WB.

Frais de livraison
Date de livraison
Livraison sous 5-8 jours ouvrables.
Téléphone
+1 (314) 370-6046
Lun - Ven, 8h - 16h AST
E-mail
orders@antibodies.com
Nom du produit
Anti-Histone H4 Antibody
Description du produit
Rabbit polyclonal antibody to Histone H4.
Applications
WB
Recommander des dilutions
WB: 1:500-1:1,000
Reactivité
Human, Mouse, Rat
Immunogène
A synthetic peptide corresponding to a sequence within amino acids 40-100 of human Histone H4 (NP_003529.1).
Séquence
RRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
Hôte
Rabbit
Clonalité
Polyclonal
Isotype
IgG
Conjuguer

Unconjugated

Purification
Affinity purification.
Masse moléculaire
11 kDa
Forme du produit
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.
Stockage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonymes
dJ160A22.1, dJ160A22.2, dJ221C16.1, dJ221C16.9, FO108, H4, H4 histone family, member A, H4 histone family, member B, H4 histone family, member C, H4 histone family, member D, H4 histone family, member E, H4 histone family, member G, H4 histone family, member H, H4 histone family, member I, H4 histone family, member J, H4 histone family, member K, H4 histone family, member M, H4 histone family, member N, H4 histone, family 2, H4.k, H4/A, H4/B, H4/C, H4/D, H4/E, H4/G, H4/H, H4/I, H4/J, H4/K, H4/M, H4/N, H4/O, H4/p, H4D, H4F2, H4F2iii, H4F2iv, H4FA, H4FB, H4FC, H4FD, H4FE, H4FG, H4FH, H4FI, H4FJ, H4FK, H4FM, H4FN, H4L, H4M, H4_HUMAN, HIST, HIST1 cluster, H4A, HIST1 cluster, H4B, HIST1 cluster, H4C, HIST1 cluster, H4D, HIST1 cluster, H4F, HIST1 cluster, H4H, HIST1 cluster, H4J, HIST1 CLUSTER, H4K, HIST1 CLUSTER, H4L, HIST1H4, HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, HIST1H4E, HIST1H4F, HIST1H4H, HIST1H4I, HIST1H4J, HIST1H4K, HIST1H4L, HIST2 cluster, H4A, HIST2H4, HIST2H4A, Hist4 cluster, H4, Hist4h4, HISTH4H4, Histone 1 H4a, Histone 1 H4b, Histone 1 H4c, Histone 1 H4d, Histone 1 H4e, Histone 1 H4f, Histone 1 H4h, Histone 1 H4i, Histone 1 H4j, Histone 1 H4k, Histone 1 H4l, histone 1, H4a, histone 1, H4b, histone 1, H4c, histone 1, H4d, histone 1, H4e, histone 1, H4f, histone 1, H4h, histone 1, H4i, histone 1, H4j, histone 1, H4k, histone 1, H4l, Histone 2 H4a, histone 2, H4a, histone 2, H4b, Histone 4 family, member M, histone 4 H4, histone 4, H4, histone cluster 1, H4, histone cluster 1, H4a, histone cluster 1, H4b, histone cluster 1, H4c, histone cluster 1, H4d, histone cluster 1, H4e, histone cluster 1, H4f, histone cluster 1, H4h, histone cluster 1, H4i, histone cluster 1, H4j, histone cluster 1, H4k, histone cluster 1, H4l, histone cluster 2, H4a, histone cluster 2, H4b, histone cluster 4, H4, histone family member, Histone family, member A, Histone family, member B, Histone family, member D, Histone family, member H, Histone family, member I, Histone family, member L, Histone gene cluster 1, H4, Histone gene cluster 1, H4 histone family, member A, Histone gene cluster 1, H4 histone family, member A - Histone gene cluster 1, H4 histone family, member C, Histone gene cluster 1, H4 histone family, member B, Histone gene cluster 1, H4 histone family, member C, Histone gene cluster 1, H4 histone family, member D, Histone gene cluster 1, H4 histone family, member E, Histone gene cluster 1, H4 histone family, member F, Histone gene cluster 1, H4 histone family, member H, Histone gene cluster 1, H4 histone family, member I, Histone gene cluster 1, H4 histone family, member J, Histone gene cluster 1, H4 histone family, member K, Histone gene cluster 1, H4 histone family, member L, Histone gene cluster 1, H4A, Histone gene cluster 1, H4B, Histone gene cluster 1, H4C, Histone gene cluster 1, H4D, Histone gene cluster 1, H4E, Histone gene cluster 1, H4F, Histone gene cluster 1, H4I, Histone gene cluster 1, H4J, Histone gene cluster 1, H4K, Histone gene cluster 1, H4KJ, Histone gene cluster 2, H4, Histone gene cluster 2, H4 histone family, member A, Histone gene cluster 2, H4A, Histone gene cluster 4, H4, Histone gene cluster 4, H4 histone, histone IV, family 2, methyl histone H4, methylated histone H4, MGC24116
Avertissement
Ce produit est uniquement destiné à la recherche. Il n'est pas destiné à un usage diagnostique ou thérapeutique.

Produits alternatifs à Anti-Histone H4 Anticorps (A13282)

Haut